| UniProt ID | 5NT3A_HUMAN | |
|---|---|---|
| UniProt AC | Q9H0P0 | |
| Protein Name | Cytosolic 5'-nucleotidase 3A {ECO:0000305|PubMed:15968458, ECO:0000305|PubMed:24603684} | |
| Gene Name | NT5C3A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 336 | |
| Subcellular Localization |
Cytoplasm . Isoform 2: Endoplasmic reticulum. |
|
| Protein Description | Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP). [PubMed: 24603684 CMP seems to be the preferred substrate] | |
| Protein Sequence | MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 1) | Phosphorylation | - | 25159151 | ||
| 47 | Ubiquitination | RKTGRKTKIIEMMPE CHHCCCEEEEEECHH | - | ||
| 57 | Ubiquitination | EMMPEFQKSSVRIKN EECHHHHHHCCCCCC | - | ||
| 77 | Ubiquitination | EIICGLIKGGAAKLQ HHHHHHHHCCCCEEE | - | ||
| 77 | Acetylation | EIICGLIKGGAAKLQ HHHHHHHHCCCCEEE | 25953088 | ||
| 91 (in isoform 1) | Ubiquitination | - | - | ||
| 116 (in isoform 1) | Ubiquitination | - | - | ||
| 128 | Ubiquitination | RKKLLQLKEKYYAIE HHHHHHHHHHEEEEE | - | ||
| 128 | 2-Hydroxyisobutyrylation | RKKLLQLKEKYYAIE HHHHHHHHHHEEEEE | - | ||
| 132 (in isoform 1) | Ubiquitination | - | - | ||
| 180 | Sulfoxidation | IVAESDVMLKEGYEN HHHHCHHHHHCHHHH | 21406390 | ||
| 182 | Ubiquitination | AESDVMLKEGYENFF HHCHHHHHCHHHHHH | - | ||
| 192 | Ubiquitination | YENFFDKLQQHSIPV HHHHHHHHHHCCCCE | 21890473 | ||
| 192 (in isoform 3) | Ubiquitination | - | 21890473 | ||
| 193 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 201 (in isoform 1) | Ubiquitination | - | - | ||
| 204 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 216 (in isoform 3) | Ubiquitination | - | 21890473 | ||
| 217 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 225 | Ubiquitination | GVYHPNVKVVSNFMD CCCCCCEEEEECCCC | - | ||
| 228 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 228 | Phosphorylation | HPNVKVVSNFMDFDE CCCEEEEECCCCCCC | 20068231 | ||
| 236 | Phosphorylation | NFMDFDETGVLKGFK CCCCCCCCCCCCCCC | 20068231 | ||
| 240 | Ubiquitination | FDETGVLKGFKGELI CCCCCCCCCCCCEEE | - | ||
| 243 | Ubiquitination | TGVLKGFKGELIHVF CCCCCCCCCEEEEEE | 21890473 | ||
| 243 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 260 | Phosphorylation | HDGALRNTEYFNQLK CCCCCCCHHHHHHCC | 28555341 | ||
| 267 | Ubiquitination | TEYFNQLKDNSNIIL HHHHHHCCCCCEEEE | 2190698 | ||
| 267 (in isoform 4) | Ubiquitination | - | 21890473 | ||
| 278 | Phosphorylation | NIILLGDSQGDLRMA EEEEEECCCCCCCCC | 29507054 | ||
| 296 | Ubiquitination | ANVEHILKIGYLNDR CCHHHHHHHHCCCHH | - | ||
| 303 | Methylation | KIGYLNDRVDELLEK HHHCCCHHHHHHHHH | 115485675 | ||
| 334 | Ubiquitination | VANSILQKIL----- HHHHHHHHHC----- | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of 5NT3A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of 5NT3A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of 5NT3A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VANG1_HUMAN | VANGL1 | physical | 21988832 | |
| RB11B_HUMAN | RAB11B | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 266120 | P5N deficiency (P5ND) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...