UniProt ID | S35F1_HUMAN | |
---|---|---|
UniProt AC | Q5T1Q4 | |
Protein Name | Solute carrier family 35 member F1 | |
Gene Name | SLC35F1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 408 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | Putative solute transporter.. | |
Protein Sequence | MIPPEQPQQQLQPPSPAPPNHVVTTIENLPAEGSGGGGSLSASSRAGVRQRIRKVLNREMLISVALGQVLSLLICGIGLTSKYLSEDFHANTPVFQSFLNYILLFLVYTTTLAVRQGEENLLAILRRRWWKYMILGLIDLEANYLVVKAYQYTTLTSIQLLDCFVIPVVILLSWFFLLIRYKAVHFIGIVVCILGMGCMVGADVLVGRHQGAGENKLVGDLLVLGGATLYGISNVWEEYIIRTLSRVEFLGMIGLFGAFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFSACMFGLYSFMPVVIKKTSATSVNLSLLTADLYSLFCGLFLFHYKFSGLYLLSFFTILIGLVLYSSTSTYIAQDPRVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Phosphorylation | LNREMLISVALGQVL HCHHHHHHHHHHHHH | 9.44 | - | |
80 | Phosphorylation | LICGIGLTSKYLSED HHHHHCCHHHHHCCC | 20.26 | 22210691 | |
81 | Phosphorylation | ICGIGLTSKYLSEDF HHHHCCHHHHHCCCC | 25.09 | 22210691 | |
144 | Phosphorylation | LIDLEANYLVVKAYQ HHHHCCCEEEEECCH | 14.12 | 19835603 | |
374 | Phosphorylation | YKQFRNPSGPVVDLP HHHHCCCCCCCCCCC | 60.31 | 29507054 | |
389 | Phosphorylation | TTAQVEPSVTYTSLG CCCCCCCCEEEECCC | 17.37 | 24173317 | |
391 | Phosphorylation | AQVEPSVTYTSLGQE CCCCCCEEEECCCCC | 25.97 | 29978859 | |
392 | Phosphorylation | QVEPSVTYTSLGQET CCCCCEEEECCCCCC | 7.68 | 24927040 | |
393 | Phosphorylation | VEPSVTYTSLGQETE CCCCEEEECCCCCCC | 14.22 | 29978859 | |
394 | Phosphorylation | EPSVTYTSLGQETEE CCCEEEECCCCCCCC | 21.79 | 29978859 | |
399 | Phosphorylation | YTSLGQETEEEPHVR EECCCCCCCCCCCCC | 40.59 | 24173317 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S35F1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S35F1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S35F1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATPB_HUMAN | ATP5B | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...