TM147_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TM147_HUMAN
• UniProt AC: Q9BVK8
• Protein Name: Transmembrane protein 147
• Gene Name: TMEM147
• Organism: Homo sapiens (Human).
• Sequence Length: 224
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Sequence: MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLALSTLALYVAVVNVHS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Ubiquitination	AGVTYLFVQLCKMLF HCHHHHHHHHHHHHH	3.81	33845483
49	Ubiquitination	YLFVQLCKMLFLATF HHHHHHHHHHHHHHH	47.43	22817900
94	Ubiquitination	VMSRNAGKGEYKIMV EECCCCCCCCHHHHH	46.27	27667366
98	Ubiquitination	NAGKGEYKIMVAALG CCCCCCHHHHHHHHH	21.74	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TM147_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TM147_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TM147_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ABI3_HUMAN	ABI3	physical	16189514
CR3L1_HUMAN	CREB3L1	physical	25416956
SYNE4_HUMAN	SYNE4	physical	25416956
LRAD1_HUMAN	LDLRAD1	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.