UniProt ID | TM147_HUMAN | |
---|---|---|
UniProt AC | Q9BVK8 | |
Protein Name | Transmembrane protein 147 | |
Gene Name | TMEM147 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 224 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIMVAALGWATAELIMSRCIPLWVGARGIEFDWKYIQMSIDSNISLVHYIVASAQVWMITRYDLYHTFRPAVLLLMFLSVYKAFVMETFVHLCSLGSWAALLARAVVTGLLALSTLALYVAVVNVHS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Ubiquitination | AGVTYLFVQLCKMLF HCHHHHHHHHHHHHH | 3.81 | 33845483 | |
49 | Ubiquitination | YLFVQLCKMLFLATF HHHHHHHHHHHHHHH | 47.43 | 22817900 | |
94 | Ubiquitination | VMSRNAGKGEYKIMV EECCCCCCCCHHHHH | 46.27 | 27667366 | |
98 | Ubiquitination | NAGKGEYKIMVAALG CCCCCCHHHHHHHHH | 21.74 | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TM147_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TM147_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TM147_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ABI3_HUMAN | ABI3 | physical | 16189514 | |
CR3L1_HUMAN | CREB3L1 | physical | 25416956 | |
SYNE4_HUMAN | SYNE4 | physical | 25416956 | |
LRAD1_HUMAN | LDLRAD1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...