UniProt ID | FITM2_HUMAN | |
---|---|---|
UniProt AC | Q8N6M3 | |
Protein Name | Fat storage-inducing transmembrane protein 2 | |
Gene Name | FITM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 262 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Plays an important role in lipid droplet accumulation. Plays a role in the regulation of cell morphology and cytoskeletal organization.. | |
Protein Sequence | MEHLERCEWLLRGTLVRAAVRRYLPWALVASMLAGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRRLSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEHQSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLHEVKTDRSHCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPKAFSPGLPPQSCSLNLKQDSYKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | VASMLAGSLLKELSP HHHHHHHHHHHHHCC | 25.56 | 24719451 | |
52 | Acetylation | PESYLSNKRNVLNVY CHHHHCCCCCEEHHH | 41.81 | 2401541 | |
52 | 2-Hydroxyisobutyrylation | PESYLSNKRNVLNVY CHHHHCCCCCEEHHH | 41.81 | - | |
259 | Phosphorylation | SLNLKQDSYKK---- CCCCCCHHCCC---- | 36.04 | 28857561 | |
260 | Phosphorylation | LNLKQDSYKK----- CCCCCHHCCC----- | 30.96 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FITM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FITM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FITM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FITM2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...