| UniProt ID | S39A1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NY26 | |
| Protein Name | Zinc transporter ZIP1 | |
| Gene Name | SLC39A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 324 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein . Shows a vesicular localization corresponding partially to the endoplasmic reticulum in several epithelial cell lines. |
|
| Protein Description | Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.. | |
| Protein Sequence | MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSEQRILKVILLLAGFALLTGLLFIQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 19 | O-linked_Glycosylation | WRPEAVASEPPVPVG ECHHHHCCCCCCCCC | 44.00 | OGP | |
| 44 | S-palmitoylation | LLVLTLLCSLVPICV HHHHHHHHHHHHHHH | 3.12 | 29575903 | |
| 50 | S-palmitoylation | LCSLVPICVLRRPGA HHHHHHHHHHCCCCC | 1.61 | 29575903 | |
| 224 | Phosphorylation | HKGILAVSLSLRLLQ HHHHHHHHHHHHHHH | 13.46 | 17081983 | |
| 226 | Phosphorylation | GILAVSLSLRLLQSH HHHHHHHHHHHHHHH | 12.16 | 17081983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S39A1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S39A1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S39A1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| LSG1_HUMAN | LSG1 | physical | 26186194 | |
| SPT6H_HUMAN | SUPT6H | physical | 26186194 | |
| SYAP1_HUMAN | SYAP1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
