dbPTM

CERS5_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CERS5_HUMAN
UniProt AC	Q8N5B7
Protein Name	Ceramide synthase 5
Gene Name	CERS5
Organism	Homo sapiens (Human).
Sequence Length	392
Subcellular Localization	Nucleus membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Dihydroceramide synthase. Catalyzes the acylation of sphingosine to form dihydroceramide, with high selectivity toward palmitoyl-CoA as acyl donor compared to stearoyl-CoA. Inhibited by fumonisin B1 (By similarity)..
Protein Sequence	MATAAQGPLSLLWGWLWSERFWLPENVSWADLEGPADGYGYPRGRHILSVFPLAAGIFFVRLLFERFIAKPCALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRKIQCWFRHRRNQDKPPTLTKFCESMWRFTFYLCIFCYGIRFLWSSPWFWDIRQCWHNYPFQPLSSGLYHYYIMELAFYWSLMFSQFTDIKRKDFLIMFVHHLVTIGLISFSYINNMVRVGTLIMCLHDVSDFLLEAAKLANYAKYQRLCDTLFVIFSAVFMVTRLGIYPFWILNTTLFESWEIIGPYASWWLLNGLLLTLQLLHVIWSYLIARIALKALIRGKVSKDDRSDVESSSEEEDVTTCTKSPCDSSSSNGANRVNGHMGGSYWAEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
26	N-linked_Glycosylation	ERFWLPENVSWADLE CCCCCCCCCCHHHCC	31.05	29632068
55	Ubiquitination	LSVFPLAAGIFFVRL HHHHHHHHHHHHHHH	21.21	21890473
55	Ubiquitination	LSVFPLAAGIFFVRL HHHHHHHHHHHHHHH	21.21	21890473
63	Ubiquitination	GIFFVRLLFERFIAK HHHHHHHHHHHHCCC	2.69	-
98	Phosphorylation	ILEKVFISITKYPDK HHHHHHHHHHCCCCH	16.85	24719451
113	Ubiquitination	KRLEGLSKQLDWNVR HHHHHHHHHCCHHHH	60.98	21890473
120	Ubiquitination	KQLDWNVRKIQCWFR HHCCHHHHHHHHHHH	27.44	27667366
121	Malonylation	QLDWNVRKIQCWFRH HCCHHHHHHHHHHHH	32.61	26320211
121	Ubiquitination	QLDWNVRKIQCWFRH HCCHHHHHHHHHHHH	32.61	-
134	Acetylation	RHRRNQDKPPTLTKF HHCCCCCCCCCHHHH	43.03	19817403
199	Ubiquitination	IMELAFYWSLMFSQF HHHHHHHHHHHHHHH	4.41	32015554
206	Ubiquitination	WSLMFSQFTDIKRKD HHHHHHHHCCCCCHH	6.85	27667366
264	Ubiquitination	AKLANYAKYQRLCDT HHHHCHHHHHHHHHH	31.40	27667366
345	Phosphorylation	ALIRGKVSKDDRSDV HHHCCCCCCCCHHHC	33.58	30108239
350	Phosphorylation	KVSKDDRSDVESSSE CCCCCCHHHCCCCCC	53.67	21082442
354	Phosphorylation	DDRSDVESSSEEEDV CCHHHCCCCCCCCCC	38.73	25159151
355	Phosphorylation	DRSDVESSSEEEDVT CHHHCCCCCCCCCCC	28.41	21082442
356	Phosphorylation	RSDVESSSEEEDVTT HHHCCCCCCCCCCCC	59.30	21082442
362	Phosphorylation	SSEEEDVTTCTKSPC CCCCCCCCCCCCCCC	28.60	20873877
363	Phosphorylation	SEEEDVTTCTKSPCD CCCCCCCCCCCCCCC	20.30	20873877
365	Phosphorylation	EEDVTTCTKSPCDSS CCCCCCCCCCCCCCC	32.25	20873877
367	Phosphorylation	DVTTCTKSPCDSSSS CCCCCCCCCCCCCCC	16.77	21815630
388	Phosphorylation	NGHMGGSYWAEE--- CCCCCCCCCCCC---	16.35	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
350	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
354	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
355	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
356	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CERS5_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CERS5_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CERS5_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CERS5_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-350; SER-354; SER-355AND SER-356, AND MASS SPECTROMETRY.	17081983 [Abstract]