dbPTM

HSPB2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HSPB2_MOUSE
UniProt AC	Q99PR8
Protein Name	Heat shock protein beta-2
Gene Name	Hspb2
Organism	Mus musculus (Mouse).
Sequence Length	182
Subcellular Localization	Cytoplasm. Nucleus. Localizes to nuclear foci..
Protein Description	May regulate the kinase DMPK..
Protein Sequence	MSGRTVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAARAGEGARAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEIARVEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
70	Phosphorylation	GASELRLSEGKFQAF CCCEEECCCCCEEEE	37.56	28464351

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HSPB2_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HSPB2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HSPB2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATP5I_MOUSE	Atp5k	physical	26465331
ATP5L_MOUSE	Atp5l	physical	26465331
CISD1_MOUSE	Cisd1	physical	26465331
CPT1B_MOUSE	Cpt1b	physical	26465331
CPT2_MOUSE	Cpt2	physical	26465331
CACP_MOUSE	Crat	physical	26465331
COX7R_MOUSE	Cox7a2l	physical	26465331
DLDH_MOUSE	Dld	physical	26465331
ODO2_MOUSE	Dlst	physical	26465331
MCCB_MOUSE	Mccc2	physical	26465331
MTFP1_MOUSE	Mtfp1	physical	26465331
NU1M_MOUSE	ND1	physical	26465331
NU4M_MOUSE	ND4	physical	26465331
NDUB3_MOUSE	Ndufb3	physical	26465331
NDUB5_MOUSE	Ndufb5	physical	26465331
NDUB6_MOUSE	Ndufb6	physical	26465331
NDUB8_MOUSE	Ndufb8	physical	26465331
NDUB9_MOUSE	Ndufb9	physical	26465331
NDUBB_MOUSE	Ndufb11	physical	26465331
NDUC2_MOUSE	Ndufc2	physical	26465331
ODO1_MOUSE	Ogdh	physical	26465331
QCR6_MOUSE	Uqcrh	physical	26465331
QCR8_MOUSE	Uqcrq	physical	26465331
CD36_MOUSE	Cd36	physical	26465331
MTCH2_MOUSE	Mtch2	physical	26465331
MTX2_MOUSE	Mtx2	physical	26465331
ADT2_MOUSE	Slc25a5	physical	26465331
CMC1_MOUSE	Slc25a12	physical	26465331
MCAT_MOUSE	Slc25a20	physical	26465331
S2542_MOUSE	Slc25a42	physical	26465331
PGBM_MOUSE	Hspg2	physical	26465331
LAMA2_MOUSE	Lama2	physical	26465331
NID1_MOUSE	Nid1	physical	26465331
VINC_MOUSE	Vcl	physical	26465331
MIC26_MOUSE	Apoo	physical	26465331
AOFB_MOUSE	Maob	physical	26465331
MCCA_MOUSE	Mccc1	physical	26465331
PLIN4_MOUSE	Plin4	physical	26465331
CRIP2_MOUSE	Crip2	physical	26465331
AUHM_MOUSE	Auh	physical	26465331
RM12_MOUSE	Mrpl12	physical	26465331
NACAM_MOUSE	Naca	physical	26465331
NACA_MOUSE	Naca	physical	26465331
SAM50_MOUSE	Samm50	physical	26465331
ACTN1_MOUSE	Actn1	physical	26465331
SPTB2_MOUSE	Sptbn1	physical	26465331
TNNC1_MOUSE	Tnnc1	physical	26465331
VIME_MOUSE	Vim	physical	26465331
AP3D1_MOUSE	Ap3d1	physical	26465331
EHD4_MOUSE	Ehd4	physical	26465331
RAB7A_MOUSE	Rab7	physical	26465331
HSP7C_MOUSE	Hspa8	physical	26465331
HSPB2_MOUSE	Hspb2	physical	26465331
OPA1_MOUSE	Opa1	physical	26465331
AIFM1_MOUSE	Aifm1	physical	26465331
MPC2_MOUSE	Mpc2	physical	26465331
ES1_MOUSE	D10Jhu81e	physical	26465331
PHB_MOUSE	Phb	physical	26465331
TIDC1_MOUSE	Timmdc1	physical	26465331

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HSPB2_MOUSE

Related Literatures of Post-Translational Modification