| UniProt ID | NDUB3_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQZ6 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 | |
| Gene Name | Ndufb3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 104 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAARGLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAGHGHEH ------CCCCCCCCC | 23.35 | - | |
| 5 | Methylation | ---MAAGHGHEHGHE ---CCCCCCCCCCCC | 29.70 | - | |
| 7 | Methylation | -MAAGHGHEHGHEHG -CCCCCCCCCCCCCC | 20.43 | - | |
| 9 | Methylation | AAGHGHEHGHEHGHG CCCCCCCCCCCCCCC | 36.92 | - | |
| 29 | Acetylation | LPDYRQWKIEGTPLE CCCHHHHEECCCCHH | 23.65 | 23576753 | |
| 29 | Succinylation | LPDYRQWKIEGTPLE CCCHHHHEECCCCHH | 23.65 | - | |
| 29 | Succinylation | LPDYRQWKIEGTPLE CCCHHHHEECCCCHH | 23.65 | 23806337 | |
| 40 | Acetylation | TPLETVQKKLAARGL CCHHHHHHHHHHCCC | 45.47 | 23576753 | |
| 40 | Succinylation | TPLETVQKKLAARGL CCHHHHHHHHHHCCC | 45.47 | - | |
| 40 | Succinylation | TPLETVQKKLAARGL CCHHHHHHHHHHCCC | 45.47 | 23806337 | |
| 41 | Succinylation | PLETVQKKLAARGLR CHHHHHHHHHHCCCC | 26.68 | 26388266 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUB3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-29 AND LYS-40, AND MASSSPECTROMETRY. | |
