UniProt ID | COX7R_MOUSE | |
---|---|---|
UniProt AC | Q61387 | |
Protein Name | Cytochrome c oxidase subunit 7A-related protein, mitochondrial | |
Gene Name | Cox7a2l | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 111 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | Involved in the regulation of oxidative phosphorylation and energy metabolism. [PubMed: 23857330] | |
Protein Sequence | MYYKFSSFTQKLAGAWASEAYTPQGLKPVSTEAPPIIFATPTKLTSSVTAYDYSGKNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | Acetylation | NKVPELQKFFQKADG CCCHHHHHHHHHCCC | 61.85 | 21728379 | |
64 | Succinylation | NKVPELQKFFQKADG CCCHHHHHHHHHCCC | 61.85 | 23806337 | |
68 | Acetylation | ELQKFFQKADGFHLK HHHHHHHHCCCCCCC | 43.20 | - | |
86 | Phosphorylation | PDQMLYRTTMALTLG CHHHHHHHHHHHHHH | 13.84 | 29895711 | |
97 | Phosphorylation | LTLGGTIYCLIALYM HHHHHHHHHHHHHHH | 4.89 | 29895711 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COX7R_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COX7R_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COX7R_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of COX7R_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...