UniProt ID | TNNC1_MOUSE | |
---|---|---|
UniProt AC | P19123 | |
Protein Name | Troponin C, slow skeletal and cardiac muscles | |
Gene Name | Tnnc1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 161 | |
Subcellular Localization | ||
Protein Description | Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.. | |
Protein Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKMMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDDIYKAA -------CHHHHHHH | 10.62 | - | |
6 | Ubiquitination | --MDDIYKAAVEQLT --CHHHHHHHHHHHC | 30.15 | 22790023 | |
17 | Ubiquitination | EQLTEEQKNEFKAAF HHHCHHHHHHHHHHH | 62.82 | 22790023 | |
35 | S-nitrosocysteine | VLGAEDGCISTKELG HHCCCCCCCCHHHHH | 3.25 | - | |
35 | S-nitrosylation | VLGAEDGCISTKELG HHCCCCCCCCHHHHH | 3.25 | 21278135 | |
39 | Ubiquitination | EDGCISTKELGKVMR CCCCCCHHHHHHHHH | 44.12 | - | |
43 | Acetylation | ISTKELGKVMRMLGQ CCHHHHHHHHHHHCC | 45.54 | 2372279 | |
43 | Ubiquitination | ISTKELGKVMRMLGQ CCHHHHHHHHHHHCC | 45.54 | 22790023 | |
90 | Ubiquitination | RCMKDDSKGKSEEEL HHHHCCCCCCCHHHH | 76.87 | 22790023 | |
92 | Ubiquitination | MKDDSKGKSEEELSD HHCCCCCCCHHHHHH | 59.43 | 22790023 | |
93 | Phosphorylation | KDDSKGKSEEELSDL HCCCCCCCHHHHHHH | 59.93 | 27742792 | |
98 | Phosphorylation | GKSEEELSDLFRMFD CCCHHHHHHHHHHHH | 35.23 | 24899341 | |
106 | Ubiquitination | DLFRMFDKNADGYID HHHHHHHCCCCCCCC | 42.65 | 22790023 | |
124 | Phosphorylation | LKMMLQATGETITED HHHHHHHHCCCCCHH | 23.69 | 25159016 | |
127 | Phosphorylation | MLQATGETITEDDIE HHHHHCCCCCHHHHH | 34.25 | 25159016 | |
129 | Phosphorylation | QATGETITEDDIEEL HHHCCCCCHHHHHHH | 40.56 | 25159016 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TNNC1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TNNC1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TNNC1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TNNC1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...