| UniProt ID | QCR8_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQ69 | |
| Protein Name | Cytochrome b-c1 complex subunit 8 | |
| Gene Name | Uqcrq | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 82 | |
| Subcellular Localization | Mitochondrion inner membrane. | |
| Protein Description | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.. | |
| Protein Sequence | MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | ARIRHVISYSLSPFE HHHHHHHHEECCHHH | 13.95 | - | |
| 29 | Phosphorylation | FEQRAFPSYFSKGIP HHHHHCHHHHCCCHH | 32.15 | 23737553 | |
| 30 | Phosphorylation | EQRAFPSYFSKGIPN HHHHCHHHHCCCHHH | 16.47 | 29472430 | |
| 32 | Phosphorylation | RAFPSYFSKGIPNVL HHCHHHHCCCHHHHH | 23.03 | 29472430 | |
| 33 | Acetylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | 23576753 | |
| 33 | Succinylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | - | |
| 33 | Ubiquitination | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | - | |
| 33 | Succinylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | 23806337 | |
| 82 | Acetylation | PAMYENDK------- HHHHCCCC------- | 74.04 | 23864654 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QCR8_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QCR8_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QCR8_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of QCR8_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Ubiquitylation | |
| Reference | PubMed |
| "A proteomics approach to identify the ubiquitinated proteins in mouseheart."; Jeon H.B., Choi E.S., Yoon J.H., Hwang J.H., Chang J.W., Lee E.K.,Choi H.W., Park Z.-Y., Yoo Y.J.; Biochem. Biophys. Res. Commun. 357:731-736(2007). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-33, AND MASSSPECTROMETRY. | |