UniProt ID | QCR8_MOUSE | |
---|---|---|
UniProt AC | Q9CQ69 | |
Protein Name | Cytochrome b-c1 complex subunit 8 | |
Gene Name | Uqcrq | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 82 | |
Subcellular Localization | Mitochondrion inner membrane. | |
Protein Description | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.. | |
Protein Sequence | MGREFGNLARIRHVISYSLSPFEQRAFPSYFSKGIPNVLRRTRERILRVAPPFVVVYLIYTWGNQEFEQSKRKNPAMYENDK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | ARIRHVISYSLSPFE HHHHHHHHEECCHHH | 13.95 | - | |
29 | Phosphorylation | FEQRAFPSYFSKGIP HHHHHCHHHHCCCHH | 32.15 | 23737553 | |
30 | Phosphorylation | EQRAFPSYFSKGIPN HHHHCHHHHCCCHHH | 16.47 | 29472430 | |
32 | Phosphorylation | RAFPSYFSKGIPNVL HHCHHHHCCCHHHHH | 23.03 | 29472430 | |
33 | Acetylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | 23576753 | |
33 | Succinylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | - | |
33 | Ubiquitination | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | - | |
33 | Succinylation | AFPSYFSKGIPNVLR HCHHHHCCCHHHHHH | 51.46 | 23806337 | |
82 | Acetylation | PAMYENDK------- HHHHCCCC------- | 74.04 | 23864654 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QCR8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QCR8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QCR8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of QCR8_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Ubiquitylation | |
Reference | PubMed |
"A proteomics approach to identify the ubiquitinated proteins in mouseheart."; Jeon H.B., Choi E.S., Yoon J.H., Hwang J.H., Chang J.W., Lee E.K.,Choi H.W., Park Z.-Y., Yoo Y.J.; Biochem. Biophys. Res. Commun. 357:731-736(2007). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-33, AND MASSSPECTROMETRY. |