UniProt ID | S2542_MOUSE | |
---|---|---|
UniProt AC | Q8R0Y8 | |
Protein Name | Mitochondrial coenzyme A transporter SLC25A42 | |
Gene Name | Slc25a42 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 318 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.. | |
Protein Sequence | MGNGVQEGSVRLREDAEAVLAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
66 | Acetylation | IIFQVSSKRFSAKEA EEEEEECCCCCHHHH | 50.37 | 23576753 | |
235 | S-nitrosocysteine | ERMVFGACAGLIGQS HHHHHHHHHHHHHHC | 2.94 | - | |
235 | S-nitrosylation | ERMVFGACAGLIGQS HHHHHHHHHHHHHHC | 2.94 | 21278135 | |
256 | Phosphorylation | VVRRRMQTAGVTGHQ HHHHHHHHCCCCCCC | 18.94 | 22871156 | |
269 | Phosphorylation | HQHGSILSTLRSIVR CCCHHHHHHHHHHHH | 24.59 | 22871156 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2542_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2542_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2542_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S2542_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...