UniProt ID | NDUB8_MOUSE | |
---|---|---|
UniProt AC | Q9D6J5 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial | |
Gene Name | Ndufb8 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 186 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
130 | S-nitrosocysteine | PVSWDVMCKHLFGFV CCCHHHHHHHHHHHH | 2.23 | - | |
130 | S-nitrosylation | PVSWDVMCKHLFGFV CCCHHHHHHHHHHHH | 2.23 | 21278135 | |
163 | Phosphorylation | VGPKQYPYNNLYLER CCCCCCCCCCEEECC | 16.26 | - | |
175 | Phosphorylation | LERGGDPTKEPEPVV ECCCCCCCCCCCCCC | 53.42 | - | |
176 | Acetylation | ERGGDPTKEPEPVVH CCCCCCCCCCCCCCC | 76.34 | 23864654 | |
176 | Ubiquitination | ERGGDPTKEPEPVVH CCCCCCCCCCCCCCC | 76.34 | 22790023 | |
184 | Phosphorylation | EPEPVVHYDI----- CCCCCCCCCC----- | 12.06 | 28464351 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUB8_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...