| UniProt ID | NDUB8_MOUSE | |
|---|---|---|
| UniProt AC | Q9D6J5 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial | |
| Gene Name | Ndufb8 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 186 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MAAARAAALGVRWLQRTTRGVVPLEARRAFHMTKDMLPGSYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPMLPNRSQHERDPWYQWDHSELRMNWGEPIHWDLDMYIRNRVDTSPTPVSWDVMCKHLFGFVAFMVFMFWVGHVFPSYQPVGPKQYPYNNLYLERGGDPTKEPEPVVHYDI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 130 | S-nitrosocysteine | PVSWDVMCKHLFGFV CCCHHHHHHHHHHHH | 2.23 | - | |
| 130 | S-nitrosylation | PVSWDVMCKHLFGFV CCCHHHHHHHHHHHH | 2.23 | 21278135 | |
| 163 | Phosphorylation | VGPKQYPYNNLYLER CCCCCCCCCCEEECC | 16.26 | - | |
| 175 | Phosphorylation | LERGGDPTKEPEPVV ECCCCCCCCCCCCCC | 53.42 | - | |
| 176 | Acetylation | ERGGDPTKEPEPVVH CCCCCCCCCCCCCCC | 76.34 | 23864654 | |
| 176 | Ubiquitination | ERGGDPTKEPEPVVH CCCCCCCCCCCCCCC | 76.34 | 22790023 | |
| 184 | Phosphorylation | EPEPVVHYDI----- CCCCCCCCCC----- | 12.06 | 28464351 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB8_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB8_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB8_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUB8_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...