| UniProt ID | NDUB6_MOUSE | |
|---|---|---|
| UniProt AC | Q3UIU2 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 | |
| Gene Name | Ndufb6 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 128 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMVFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMRDFPDQHH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSGYTPDEK ------CCCCCCCHH | 40.27 | - | |
| 9 | Acetylation | SGYTPDEKLRLQQLR CCCCCCHHHHHHHHH | 46.41 | 23954790 | |
| 24 | Acetylation | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | 23576753 | |
| 24 | Succinylation | ELRRRWLKDQELSPR HHHHHHHHCCCCCCC | 50.86 | 26388266 | |
| 63 | Acetylation | VWKNMVFKAYRSSLF HHHHHHHHHHHHHHH | 32.85 | 23954790 | |
| 63 | Succinylation | VWKNMVFKAYRSSLF HHHHHHHHHHHHHHH | 32.85 | 23954790 | |
| 93 | Acetylation | VKYHMATKPYTIVSS HHHHCCCCCEEEECC | 26.87 | 23806337 | |
| 93 | Succinylation | VKYHMATKPYTIVSS HHHHCCCCCEEEECC | 26.87 | 23806337 | |
| 99 | Phosphorylation | TKPYTIVSSKPRIFP CCCEEEECCCCCCCC | 28.88 | 27841257 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB6_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB6_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB6_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUB6_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...