NDUC2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUC2_MOUSE
• UniProt AC: Q9CQ54
• Protein Name: NADH dehydrogenase [ubiquinone] 1 subunit C2
• Gene Name: Ndufc2
• Organism: Mus musculus (Mouse).
• Sequence Length: 120
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein ; Matrix side .
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
• Protein Sequence: MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMDNMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEKEKKTYAEILEPFHPVR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
40	S-nitrosocysteine	YMGLLGYCTGLMDNM HHHHHHHHHHHHHHH	2.00	-
40	S-nitrosylation	YMGLLGYCTGLMDNM HHHHHHHHHHHHHHH	2.00	21278135
104	Acetylation	HPEDFPEKEKKTYAE CHHHCCHHHHCCHHH	75.07	23201123
109	Phosphorylation	PEKEKKTYAEILEPF CHHHHCCHHHHHCCC	15.89	28418008

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUC2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUC2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUC2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NDUC2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.