| UniProt ID | RM12_MOUSE | |
|---|---|---|
| UniProt AC | Q9DB15 | |
| Protein Name | 39S ribosomal protein L12, mitochondrial | |
| Gene Name | Mrpl12 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 201 | |
| Subcellular Localization | Mitochondrion. | |
| Protein Description | ||
| Protein Sequence | MLPVAASRCLWGPRLGLRGAALRLARQQMPSVCAARQLRSSSHRRSEALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEEDVPKQKERTHFTVRLTEAKPVDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | RSSSHRRSEALAGAP HCCCCCCHHHHCCCC | 27.46 | 29472430 | |
| 141 | Acetylation | TVRLTEAKPVDKVKL EEEECCCCCCCHHHH | 39.06 | 23576753 | |
| 141 | Succinylation | TVRLTEAKPVDKVKL EEEECCCCCCCHHHH | 39.06 | 23954790 | |
| 145 | Acetylation | TEAKPVDKVKLIKEI CCCCCCCHHHHHHHH | 41.31 | 23864654 | |
| 147 | Acetylation | AKPVDKVKLIKEIKN CCCCCHHHHHHHHHH | 50.68 | 23864654 | |
| 150 | Acetylation | VDKVKLIKEIKNYVQ CCHHHHHHHHHHHHC | 64.92 | 23201123 | |
| 153 | Succinylation | VKLIKEIKNYVQGIN HHHHHHHHHHHCCCC | 43.23 | - | |
| 153 | Acetylation | VKLIKEIKNYVQGIN HHHHHHHHHHHCCCC | 43.23 | 23806337 | |
| 153 | Succinylation | VKLIKEIKNYVQGIN HHHHHHHHHHHCCCC | 43.23 | 23806337 | |
| 153 | Malonylation | VKLIKEIKNYVQGIN HHHHHHHHHHHCCCC | 43.23 | 26320211 | |
| 165 | Succinylation | GINLVQAKKLVESLP CCCHHHHHHHHHCCC | 29.55 | - | |
| 165 | Glutarylation | GINLVQAKKLVESLP CCCHHHHHHHHHCCC | 29.55 | 24703693 | |
| 165 | Acetylation | GINLVQAKKLVESLP CCCHHHHHHHHHCCC | 29.55 | 23806337 | |
| 165 | Malonylation | GINLVQAKKLVESLP CCCHHHHHHHHHCCC | 29.55 | 26320211 | |
| 165 | Succinylation | GINLVQAKKLVESLP CCCHHHHHHHHHCCC | 29.55 | 23806337 | |
| 166 | Glutarylation | INLVQAKKLVESLPQ CCHHHHHHHHHCCCH | 61.86 | 24703693 | |
| 166 | Acetylation | INLVQAKKLVESLPQ CCHHHHHHHHHCCCH | 61.86 | 23806337 | |
| 166 | Succinylation | INLVQAKKLVESLPQ CCHHHHHHHHHCCCH | 61.86 | 23806337 | |
| 181 | Succinylation | EIKANVAKAEAEKIK HHHHHHHHHHHHHHH | 42.34 | 23806337 | |
| 181 | Acetylation | EIKANVAKAEAEKIK HHHHHHHHHHHHHHH | 42.34 | 23806337 | |
| 181 | Succinylation | EIKANVAKAEAEKIK HHHHHHHHHHHHHHH | 42.34 | - | |
| 181 | Glutarylation | EIKANVAKAEAEKIK HHHHHHHHHHHHHHH | 42.34 | 24703693 | |
| 186 | Acetylation | VAKAEAEKIKAALEA HHHHHHHHHHHHHHH | 57.46 | 23864654 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RM12_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RM12_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RM12_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RM12_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...