| UniProt ID | PHB_MOUSE | |
|---|---|---|
| UniProt AC | P67778 | |
| Protein Name | Prohibitin | |
| Gene Name | Phb | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 272 | |
| Subcellular Localization | Mitochondrion inner membrane . | |
| Protein Description | Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).. | |
| Protein Sequence | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAKVFESI ------CCHHHHHHH | 18.91 | - | |
| 4 | Acetylation | ----MAAKVFESIGK ----CCHHHHHHHHH | 37.61 | 23576753 | |
| 4 | Succinylation | ----MAAKVFESIGK ----CCHHHHHHHHH | 37.61 | 26388266 | |
| 80 | Phosphorylation | PRNVPVITGSKDLQN CCCCCEEECCCCHHC | 35.32 | 28464351 | |
| 83 | Succinylation | VPVITGSKDLQNVNI CCEEECCCCHHCCCE | 64.90 | 23954790 | |
| 83 | Malonylation | VPVITGSKDLQNVNI CCEEECCCCHHCCCE | 64.90 | 26320211 | |
| 83 | Ubiquitination | VPVITGSKDLQNVNI CCEEECCCCHHCCCE | 64.90 | 27667366 | |
| 91 | Phosphorylation | DLQNVNITLRILFRP CHHCCCEEEHHHHHH | 12.55 | - | |
| 101 | Phosphorylation | ILFRPVASQLPRIYT HHHHHHHHCCCCEEH | 32.27 | 22817900 | |
| 107 | Phosphorylation | ASQLPRIYTSIGEDY HHCCCCEEHHCCCCC | 8.84 | 23023260 | |
| 109 | Phosphorylation | QLPRIYTSIGEDYDE CCCCEEHHCCCCCCC | 16.18 | - | |
| 114 | Phosphorylation | YTSIGEDYDERVLPS EHHCCCCCCCCCCCH | 18.53 | - | |
| 121 | Phosphorylation | YDERVLPSITTEILK CCCCCCCHHHHHHHH | 28.53 | 28066266 | |
| 123 | Phosphorylation | ERVLPSITTEILKSV CCCCCHHHHHHHHHH | 23.78 | 28066266 | |
| 124 | Phosphorylation | RVLPSITTEILKSVV CCCCHHHHHHHHHHH | 21.25 | 29472430 | |
| 128 | Succinylation | SITTEILKSVVARFD HHHHHHHHHHHHHCC | 47.03 | 24315375 | |
| 128 | Acetylation | SITTEILKSVVARFD HHHHHHHHHHHHHCC | 47.03 | 23576753 | |
| 128 | Ubiquitination | SITTEILKSVVARFD HHHHHHHHHHHHHCC | 47.03 | - | |
| 141 | Phosphorylation | FDAGELITQRELVSR CCCCHHCCHHHHHHH | 33.91 | - | |
| 151 | Phosphorylation | ELVSRQVSDDLTERA HHHHHHCCCHHHHHH | 19.64 | 26824392 | |
| 155 | Phosphorylation | RQVSDDLTERAATFG HHCCCHHHHHHHHHC | 30.35 | 21743459 | |
| 186 | Acetylation | FTEAVEAKQVAQQEA HHHHHHHHHHHHHHH | 31.62 | 23576753 | |
| 186 | Ubiquitination | FTEAVEAKQVAQQEA HHHHHHHHHHHHHHH | 31.62 | - | |
| 186 | Malonylation | FTEAVEAKQVAQQEA HHHHHHHHHHHHHHH | 31.62 | 26320211 | |
| 202 | Succinylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | - | |
| 202 | Acetylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | 23576753 | |
| 202 | Malonylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | 26320211 | |
| 202 | Succinylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | 23806337 | |
| 207 | Acetylation | VEKAEQQKKAAIISA HHHHHHHHHEEEEEC | 44.04 | 2388327 | |
| 208 | Malonylation | EKAEQQKKAAIISAE HHHHHHHHEEEEECC | 38.42 | 25418362 | |
| 208 | Acetylation | EKAEQQKKAAIISAE HHHHHHHHEEEEECC | 38.42 | 7622489 | |
| 213 | Phosphorylation | QKKAAIISAEGDSKA HHHEEEEECCCCHHH | 17.72 | 23737553 | |
| 218 | Phosphorylation | IISAEGDSKAAELIA EEECCCCHHHHHHHH | 34.74 | 28066266 | |
| 219 | Acetylation | ISAEGDSKAAELIAN EECCCCHHHHHHHHH | 57.25 | 23954790 | |
| 249 | Nitration | EAAEDIAYQLSRSRN HHHHHHHHHHHCCCC | 15.43 | - | |
| 249 | Phosphorylation | EAAEDIAYQLSRSRN HHHHHHHHHHHCCCC | 15.43 | 27742792 | |
| 252 | Phosphorylation | EDIAYQLSRSRNITY HHHHHHHHCCCCCEE | 16.82 | 27742792 | |
| 258 | Phosphorylation | LSRSRNITYLPAGQS HHCCCCCEEECCCCE | 23.66 | 22388104 | |
| 259 | Phosphorylation | SRSRNITYLPAGQSV HCCCCCEEECCCCEE | 13.59 | - | |
| 265 | Phosphorylation | TYLPAGQSVLLQLPQ EEECCCCEEEECCCC | 17.51 | 23140645 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHB_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHB_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PHB_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-249, AND MASSSPECTROMETRY. | |