| UniProt ID | TIDC1_MOUSE | |
|---|---|---|
| UniProt AC | Q8BUY5 | |
| Protein Name | Complex I assembly factor TIMMDC1, mitochondrial | |
| Gene Name | Timmdc1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 285 | |
| Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein. |
|
| Protein Description | Chaperone protein involved in the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Participates in constructing the membrane arm of complex I (By similarity).. | |
| Protein Sequence | MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQLFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFRINLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSLQVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 83 | Phosphorylation | YIYRAAVSAGIIGWA HHHHHHHHHCCHHHH | 18.95 | 26026062 | |
| 151 | Phosphorylation | VFVTIFNTVNTGLTV EEEHHHCCCCCCCEE | 12.37 | 20139300 | |
| 154 | Phosphorylation | TIFNTVNTGLTVYRN HHHCCCCCCCEEEEC | 29.27 | 20139300 | |
| 159 | Phosphorylation | VNTGLTVYRNKDAMS CCCCCEEEECCCHHH | 11.84 | 20139300 | |
| 192 | Phosphorylation | VRGLVAGSIIGALLG CHHHHHHHHHHHHHC | 10.99 | - | |
| 204 | Phosphorylation | LLGAPMGSLLMALEK HHCCCHHHHHHHHHH | 16.45 | - | |
| 271 | Phosphorylation | QRIEELLSLPRNPSS HHHHHHHCCCCCCCC | 49.29 | 28066266 | |
| 277 | Phosphorylation | LSLPRNPSSPHQQSK HCCCCCCCCCCCCCC | 61.11 | 23684622 | |
| 278 | Phosphorylation | SLPRNPSSPHQQSKH CCCCCCCCCCCCCCC | 27.88 | 23140645 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIDC1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIDC1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIDC1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of TIDC1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
