UniProt ID | NDUB5_MOUSE | |
---|---|---|
UniProt AC | Q9CQH3 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | |
Gene Name | Ndufb5 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 189 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | GPRLGVGSFLTRSFP CCCCCCCCCCCCCCC | 18.06 | 28285833 | |
36 | Phosphorylation | VGSFLTRSFPKTVAP CCCCCCCCCCCCEEC | 40.44 | - | |
40 | Phosphorylation | LTRSFPKTVAPVRHS CCCCCCCCEECCEEC | 23.34 | - | |
58 | Acetylation | GKRLFVVKPSLYYDA CCEEEEECHHHHHCH | 24.48 | 23864654 | |
58 | Succinylation | GKRLFVVKPSLYYDA CCEEEEECHHHHHCH | 24.48 | 23954790 | |
131 | Acetylation | NFYDGPEKNYEKTLA HCCCCCCCCHHHHHH | 68.88 | 24062335 | |
136 | Phosphorylation | PEKNYEKTLAILQIE CCCCHHHHHHHEEEH | 14.96 | 28494245 | |
144 | Phosphorylation | LAILQIESEKAELRL HHHEEEHHHHHHHHH | 46.13 | 28494245 | |
152 | Acetylation | EKAELRLKEQEVRRL HHHHHHHHHHHHHHH | 51.41 | 24062335 | |
152 | Succinylation | EKAELRLKEQEVRRL HHHHHHHHHHHHHHH | 51.41 | 26388266 | |
176 | Acetylation | YQFPTPEKEFIDHSP CCCCCCCHHHCCCCC | 60.16 | 23954790 | |
182 | Phosphorylation | EKEFIDHSPKATPDN CHHHCCCCCCCCCCC | 25.09 | 27742792 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB5_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB5_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB5_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUB5_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...