| UniProt ID | NDUB5_MOUSE | |
|---|---|---|
| UniProt AC | Q9CQH3 | |
| Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial | |
| Gene Name | Ndufb5 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 189 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein Matrix side . |
|
| Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
| Protein Sequence | MAAMSLLQRASVSALTALSCRRAGPRLGVGSFLTRSFPKTVAPVRHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQFPTPEKEFIDHSPKATPDN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | GPRLGVGSFLTRSFP CCCCCCCCCCCCCCC | 18.06 | 28285833 | |
| 36 | Phosphorylation | VGSFLTRSFPKTVAP CCCCCCCCCCCCEEC | 40.44 | - | |
| 40 | Phosphorylation | LTRSFPKTVAPVRHS CCCCCCCCEECCEEC | 23.34 | - | |
| 58 | Acetylation | GKRLFVVKPSLYYDA CCEEEEECHHHHHCH | 24.48 | 23864654 | |
| 58 | Succinylation | GKRLFVVKPSLYYDA CCEEEEECHHHHHCH | 24.48 | 23954790 | |
| 131 | Acetylation | NFYDGPEKNYEKTLA HCCCCCCCCHHHHHH | 68.88 | 24062335 | |
| 136 | Phosphorylation | PEKNYEKTLAILQIE CCCCHHHHHHHEEEH | 14.96 | 28494245 | |
| 144 | Phosphorylation | LAILQIESEKAELRL HHHEEEHHHHHHHHH | 46.13 | 28494245 | |
| 152 | Acetylation | EKAELRLKEQEVRRL HHHHHHHHHHHHHHH | 51.41 | 24062335 | |
| 152 | Succinylation | EKAELRLKEQEVRRL HHHHHHHHHHHHHHH | 51.41 | 26388266 | |
| 176 | Acetylation | YQFPTPEKEFIDHSP CCCCCCCHHHCCCCC | 60.16 | 23954790 | |
| 182 | Phosphorylation | EKEFIDHSPKATPDN CHHHCCCCCCCCCCC | 25.09 | 27742792 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUB5_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUB5_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUB5_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDUB5_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...