UniProt ID | MCAT_MOUSE | |
---|---|---|
UniProt AC | Q9Z2Z6 | |
Protein Name | Mitochondrial carnitine/acylcarnitine carrier protein | |
Gene Name | Slc25a20 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 301 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.. | |
Protein Sequence | MADEPKPISPFKNLLAGGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELSYPQLFTAGMLSGVFTTGIMTPGERIKCLLQIQASSGENKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPEGKSVSDLSVPRILVAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKFLNWIAPNL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADEPKPIS ------CCCCCCCCC | 29.85 | - | |
6 | Acetylation | --MADEPKPISPFKN --CCCCCCCCCHHHH | 53.59 | 23201123 | |
9 | Phosphorylation | ADEPKPISPFKNLLA CCCCCCCCHHHHHHC | 32.58 | 20469934 | |
58 | S-nitrosocysteine | MYSGTLDCFRKTLMR CCCCHHHHHHHHHHH | 3.90 | - | |
58 | S-palmitoylation | MYSGTLDCFRKTLMR CCCCHHHHHHHHHHH | 3.90 | 28526873 | |
58 | S-nitrosylation | MYSGTLDCFRKTLMR CCCCHHHHHHHHHHH | 3.90 | 21278135 | |
136 | S-nitrosylation | TPGERIKCLLQIQAS CCCHHEEEEEEEEEC | 4.22 | 21278135 | |
136 | S-nitrosocysteine | TPGERIKCLLQIQAS CCCHHEEEEEEEEEC | 4.22 | - | |
143 | Phosphorylation | CLLQIQASSGENKYS EEEEEEECCCCCCCC | 23.62 | 25521595 | |
144 | Phosphorylation | LLQIQASSGENKYSG EEEEEECCCCCCCCC | 53.82 | 25521595 | |
148 | Acetylation | QASSGENKYSGTLDC EECCCCCCCCCHHHH | 36.17 | 23576753 | |
155 | S-nitrosocysteine | KYSGTLDCAKKLYQE CCCCHHHHHHHHHHH | 7.23 | - | |
155 | S-nitrosylation | KYSGTLDCAKKLYQE CCCCHHHHHHHHHHH | 7.23 | 21278135 | |
157 | Acetylation | SGTLDCAKKLYQEFG CCHHHHHHHHHHHHC | 50.03 | 23576753 | |
158 | Acetylation | GTLDCAKKLYQEFGI CHHHHHHHHHHHHCC | 33.62 | 23576753 | |
170 | Acetylation | FGIRGFYKGTVLTLM HCCCCEEECCEEEEE | 45.93 | 23576753 | |
170 | Succinylation | FGIRGFYKGTVLTLM HCCCCEEECCEEEEE | 45.93 | - | |
170 | Succinylation | FGIRGFYKGTVLTLM HCCCCEEECCEEEEE | 45.93 | 23806337 | |
202 | Ubiquitination | NLFTPEGKSVSDLSV HHCCCCCCCHHHCCC | 46.12 | - | |
244 | Acetylation | FQTAPPGKYPNGFRD HCCCCCCCCCCCHHH | 64.41 | 23864654 | |
283 | S-nitrosocysteine | AFPANAACFLGFEIA ECCCCHHHHHHHHHH | 2.41 | - | |
283 | S-nitrosylation | AFPANAACFLGFEIA ECCCCHHHHHHHHHH | 2.41 | 21278135 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MCAT_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MCAT_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MCAT_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MCAT_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Substrate and functional diversity of lysine acetylation revealed bya proteomics survey."; Kim S.C., Sprung R., Chen Y., Xu Y., Ball H., Pei J., Cheng T.,Kho Y., Xiao H., Xiao L., Grishin N.V., White M., Yang X.-J., Zhao Y.; Mol. Cell 23:607-618(2006). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-148 AND LYS-244, AND MASSSPECTROMETRY. |