UniProt ID | NDUBB_MOUSE | |
---|---|---|
UniProt AC | O09111 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial | |
Gene Name | Ndufb11 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 151 | |
Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MAARLLSLYGRCLSAAGAMRGLPAARVRWESSRAVIAPSGVEKKRQREPTMQWQEDPEPEDENVYAKNPDFHGYDSDPVVDVWNMRAVFFFGFSIVLVFGTTFVAYVPDYRMQEWARREAERLVKYREVNGLPIMESNYFDPSKIQLPEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Phosphorylation | SRAVIAPSGVEKKRQ CCEEECCCCCCHHHC | 46.58 | 23140645 | |
43 | Acetylation | IAPSGVEKKRQREPT ECCCCCCHHHCCCCC | 51.34 | 23864654 | |
43 | Succinylation | IAPSGVEKKRQREPT ECCCCCCHHHCCCCC | 51.34 | 23806337 | |
43 | Malonylation | IAPSGVEKKRQREPT ECCCCCCHHHCCCCC | 51.34 | 26320211 | |
126 | Phosphorylation | EAERLVKYREVNGLP HHHHHHHHHHHCCEE | 12.43 | 30165576 | |
127 | Methylation | AERLVKYREVNGLPI HHHHHHHHHHCCEEC | 35.35 | 4199143 | |
137 | Phosphorylation | NGLPIMESNYFDPSK CCEECCCCCCCCHHH | 21.32 | 22210690 | |
139 | Phosphorylation | LPIMESNYFDPSKIQ EECCCCCCCCHHHCC | 20.73 | 22210690 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUBB_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUBB_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUBB_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUBB_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...