UniProt ID | CEP57_HUMAN | |
---|---|---|
UniProt AC | Q86XR8 | |
Protein Name | Centrosomal protein of 57 kDa | |
Gene Name | CEP57 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 500 | |
Subcellular Localization | Nucleus. Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. | |
Protein Description | Centrosomal protein which may be required for microtubule attachment to centrosomes. May act by forming ring-like structures around microtubules. Mediates nuclear translocation and mitogenic activity of the internalized growth factor FGF2, but that of FGF1.. | |
Protein Sequence | MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAAASVSAASGS ---CCCCCCCCCCCC | 16.33 | 27251275 | |
7 | O-linked_Glycosylation | -MAAASVSAASGSHL -CCCCCCCCCCCCCC | 18.67 | 29485866 | |
7 | Phosphorylation | -MAAASVSAASGSHL -CCCCCCCCCCCCCC | 18.67 | 29255136 | |
10 | Phosphorylation | AASVSAASGSHLSNS CCCCCCCCCCCCCCC | 40.31 | 29255136 | |
12 | Phosphorylation | SVSAASGSHLSNSFA CCCCCCCCCCCCCCC | 20.82 | 29255136 | |
13 (in isoform 4) | Phosphorylation | - | 36.48 | 26503514 | |
13 (in isoform 5) | Phosphorylation | - | 36.48 | 26503514 | |
15 | Phosphorylation | AASGSHLSNSFAEPS CCCCCCCCCCCCCCC | 25.63 | 29255136 | |
17 | Phosphorylation | SGSHLSNSFAEPSRS CCCCCCCCCCCCCCC | 23.58 | 29255136 | |
22 | Phosphorylation | SNSFAEPSRSNGSMV CCCCCCCCCCCCCCC | 39.59 | 29255136 | |
32 | Phosphorylation | NGSMVRHSSSPYVVY CCCCCCCCCCCEEEC | 23.19 | 30108239 | |
33 | Phosphorylation | GSMVRHSSSPYVVYP CCCCCCCCCCEEECC | 29.25 | 25849741 | |
34 | Phosphorylation | SMVRHSSSPYVVYPS CCCCCCCCCEEECCC | 24.22 | 25849741 | |
34 | Ubiquitination | SMVRHSSSPYVVYPS CCCCCCCCCEEECCC | 24.22 | 29967540 | |
36 | Phosphorylation | VRHSSSPYVVYPSDK CCCCCCCEEECCCCC | 12.42 | 30576142 | |
39 | Phosphorylation | SSSPYVVYPSDKPFL CCCCEEECCCCCCCC | 6.23 | 29496907 | |
41 | Phosphorylation | SPYVVYPSDKPFLNS CCEEECCCCCCCCCC | 40.35 | 28634298 | |
43 | Ubiquitination | YVVYPSDKPFLNSDL EEECCCCCCCCCCCC | 41.84 | 29967540 | |
44 | Phosphorylation | VVYPSDKPFLNSDLR EECCCCCCCCCCCCC | 43.90 | 33259812 | |
47 | Ubiquitination | PSDKPFLNSDLRRSP CCCCCCCCCCCCCCC | 33.58 | 29967540 | |
48 | Phosphorylation | SDKPFLNSDLRRSPS CCCCCCCCCCCCCCC | 39.92 | 23312004 | |
53 | Phosphorylation | LNSDLRRSPSKPTLA CCCCCCCCCCCCCCC | 27.39 | 22617229 | |
55 | Phosphorylation | SDLRRSPSKPTLAYP CCCCCCCCCCCCCCC | 53.14 | 23401153 | |
56 | Ubiquitination | DLRRSPSKPTLAYPE CCCCCCCCCCCCCCC | 45.46 | 29967540 | |
58 | Phosphorylation | RRSPSKPTLAYPESN CCCCCCCCCCCCCCH | 27.97 | 30278072 | |
61 | Phosphorylation | PSKPTLAYPESNSRA CCCCCCCCCCCHHHH | 15.62 | 30108239 | |
64 | Phosphorylation | PTLAYPESNSRAIFS CCCCCCCCHHHHHHH | 35.28 | 23312004 | |
66 | Phosphorylation | LAYPESNSRAIFSAL CCCCCCHHHHHHHHH | 32.16 | 23312004 | |
70 | Ubiquitination | ESNSRAIFSALKNLQ CCHHHHHHHHHHHHH | 3.22 | 29967540 | |
74 | Ubiquitination | RAIFSALKNLQDKIR HHHHHHHHHHHHHHH | 56.16 | - | |
79 | Ubiquitination | ALKNLQDKIRRLELE HHHHHHHHHHHHHHH | 25.75 | 29967540 | |
86 | Ubiquitination | KIRRLELERIQAEES HHHHHHHHHHHHHHH | 38.06 | 23000965 | |
86 (in isoform 4) | Ubiquitination | - | 38.06 | 21890473 | |
95 | Ubiquitination | IQAEESVKTLSRETI HHHHHHHHHHCHHHH | 53.69 | 23000965 | |
95 (in isoform 1) | Ubiquitination | - | 53.69 | 21890473 | |
95 (in isoform 2) | Ubiquitination | - | 53.69 | 21890473 | |
95 (in isoform 3) | Ubiquitination | - | 53.69 | 21890473 | |
96 | Phosphorylation | QAEESVKTLSRETIE HHHHHHHHHCHHHHH | 28.01 | - | |
96 | Ubiquitination | QAEESVKTLSRETIE HHHHHHHHHCHHHHH | 28.01 | 29967540 | |
97 | Ubiquitination | AEESVKTLSRETIEY HHHHHHHHCHHHHHH | 3.63 | 29967540 | |
101 | Phosphorylation | VKTLSRETIEYKKVL HHHHCHHHHHHHHHH | 20.28 | - | |
104 | Phosphorylation | LSRETIEYKKVLDEQ HCHHHHHHHHHHHHH | 16.56 | - | |
105 | Ubiquitination | SRETIEYKKVLDEQI CHHHHHHHHHHHHHH | 24.50 | 29967540 | |
106 | Ubiquitination | RETIEYKKVLDEQIQ HHHHHHHHHHHHHHH | 47.32 | 29967540 | |
110 | Ubiquitination | EYKKVLDEQIQEREN HHHHHHHHHHHHHHH | 45.48 | 29967540 | |
115 | Ubiquitination | LDEQIQERENSKNEE HHHHHHHHHHCCCHH | 31.83 | 29967540 | |
118 | Phosphorylation | QIQERENSKNEESKH HHHHHHHCCCHHHHH | 31.91 | 30576142 | |
119 | Ubiquitination | IQERENSKNEESKHN HHHHHHCCCHHHHHH | 78.82 | 29967540 | |
124 | Ubiquitination | NSKNEESKHNQELTS HCCCHHHHHHHHHHH | 50.26 | 29967540 | |
130 | Ubiquitination | SKHNQELTSQLLAAE HHHHHHHHHHHHHHH | 17.42 | 29967540 | |
136 | Ubiquitination | LTSQLLAAENKCNLL HHHHHHHHHHHHCHH | 22.36 | 29967540 | |
139 | Ubiquitination | QLLAAENKCNLLEKQ HHHHHHHHHCHHHHH | 18.92 | 29967540 | |
145 | Ubiquitination | NKCNLLEKQLEYMRN HHHCHHHHHHHHHHH | 61.22 | 29967540 | |
146 | Ubiquitination | KCNLLEKQLEYMRNM HHCHHHHHHHHHHHH | 30.10 | 29967540 | |
149 | Phosphorylation | LLEKQLEYMRNMIKH HHHHHHHHHHHHHHH | 15.23 | 22817900 | |
155 | Ubiquitination | EYMRNMIKHAEMERT HHHHHHHHHHHHHHH | 26.45 | 29967540 | |
158 | Ubiquitination | RNMIKHAEMERTSVL HHHHHHHHHHHHHHH | 41.10 | 21890473 | |
158 (in isoform 4) | Ubiquitination | - | 41.10 | 21890473 | |
167 | Ubiquitination | ERTSVLEKQVSLERE HHHHHHHHHHHHHHH | 52.41 | 23000965 | |
167 (in isoform 1) | Ubiquitination | - | 52.41 | 21890473 | |
167 (in isoform 2) | Ubiquitination | - | 52.41 | 21890473 | |
167 (in isoform 3) | Ubiquitination | - | 52.41 | 21890473 | |
170 | Phosphorylation | SVLEKQVSLERERQH HHHHHHHHHHHHHHH | 23.24 | 24719451 | |
179 | Ubiquitination | ERERQHDQTHVQSQL HHHHHHCHHHHHHHH | 31.23 | 29967540 | |
188 | Ubiquitination | HVQSQLEKLDLLEQE HHHHHHHHHHHHHHH | 56.76 | 29967540 | |
189 | Ubiquitination | VQSQLEKLDLLEQEY HHHHHHHHHHHHHHH | 4.02 | 29967540 | |
198 | Ubiquitination | LLEQEYNKLTTMQAL HHHHHHHHHHHHHHH | 46.43 | 29967540 | |
199 | Ubiquitination | LEQEYNKLTTMQALA HHHHHHHHHHHHHHH | 4.25 | 29967540 | |
200 | Phosphorylation | EQEYNKLTTMQALAE HHHHHHHHHHHHHHH | 23.10 | 20860994 | |
201 | Phosphorylation | QEYNKLTTMQALAEK HHHHHHHHHHHHHHH | 20.09 | 29083192 | |
208 | Ubiquitination | TMQALAEKKMQELEA HHHHHHHHHHHHHHH | 48.19 | 29967540 | |
209 | Ubiquitination | MQALAEKKMQELEAK HHHHHHHHHHHHHHH | 37.00 | 22505724 | |
216 | Ubiquitination | KMQELEAKLHEEEQE HHHHHHHHHHHHHHH | 40.79 | 29967540 | |
221 | Ubiquitination | EAKLHEEEQERKRMQ HHHHHHHHHHHHHHH | 55.55 | 29967540 | |
225 | Ubiquitination | HEEEQERKRMQAKAA HHHHHHHHHHHHHHH | 52.01 | 29967540 | |
230 | Ubiquitination | ERKRMQAKAAELQTG HHHHHHHHHHHHHHH | 31.10 | 29967540 | |
239 | Ubiquitination | AELQTGLETNRLIFE HHHHHHHHHCCCCCC | 45.44 | 22505724 | |
248 | Ubiquitination | NRLIFEDKATPCVPN CCCCCCCCCCCCCCC | 47.14 | 22505724 | |
250 | Phosphorylation | LIFEDKATPCVPNAR CCCCCCCCCCCCCHH | 23.98 | 28555341 | |
264 | Phosphorylation | RRIKKKKSKPPEKKS HHHHCCCCCCCCCCC | 60.31 | 26657352 | |
265 | Sumoylation | RIKKKKSKPPEKKSS HHHCCCCCCCCCCCC | 73.75 | - | |
265 | Acetylation | RIKKKKSKPPEKKSS HHHCCCCCCCCCCCC | 73.75 | 12433715 | |
265 | Sumoylation | RIKKKKSKPPEKKSS HHHCCCCCCCCCCCC | 73.75 | - | |
269 | Acetylation | KKSKPPEKKSSRNYF CCCCCCCCCCCCCCC | 64.82 | 12433725 | |
293 | Ubiquitination | LGDMPFVAGKSTSPS CCCCCCCCCCCCCHH | 21.78 | 29967540 | |
308 | Ubiquitination | HAVVANVQLVLHLMK HHHHHHHHHHHHHHH | 26.17 | 29967540 | |
310 | Ubiquitination | VVANVQLVLHLMKQH HHHHHHHHHHHHHHH | 1.44 | 29967540 | |
319 | Ubiquitination | HLMKQHSKALCNDRV HHHHHHHHHHHCCCC | 43.16 | 29967540 | |
325 | Ubiquitination | SKALCNDRVINSIPL HHHHHCCCCHHHHHH | 19.75 | 29967540 | |
334 | Ubiquitination | INSIPLAKQVSSRGG HHHHHHHHHHHCCCC | 59.94 | 29967540 | |
347 | Phosphorylation | GGKSKKLSVTPPSSN CCCCCCCCCCCCCCC | 32.59 | 28450419 | |
349 | Phosphorylation | KSKKLSVTPPSSNGI CCCCCCCCCCCCCCC | 26.55 | 28450419 | |
352 | Phosphorylation | KLSVTPPSSNGINEE CCCCCCCCCCCCCHH | 37.32 | 28450419 | |
353 | Phosphorylation | LSVTPPSSNGINEEL CCCCCCCCCCCCHHH | 44.86 | 28450419 | |
361 | Phosphorylation | NGINEELSEVLQTLQ CCCCHHHHHHHHHHH | 29.01 | 28450419 | |
368 | Ubiquitination | SEVLQTLQDEFGQMS HHHHHHHHHHHHCCC | 52.13 | 29967540 | |
370 | Ubiquitination | VLQTLQDEFGQMSFD HHHHHHHHHHCCCCC | 38.42 | 29967540 | |
385 | Ubiquitination | HQQLAKLIQESPTVE HHHHHHHHHHCCCCC | 4.15 | 29967540 | |
387 | Ubiquitination | QLAKLIQESPTVELK HHHHHHHHCCCCCHH | 52.25 | 29967540 | |
388 | Phosphorylation | LAKLIQESPTVELKD HHHHHHHCCCCCHHH | 14.97 | 28348404 | |
390 | Phosphorylation | KLIQESPTVELKDKL HHHHHCCCCCHHHHH | 35.57 | 19691289 | |
391 | Ubiquitination | LIQESPTVELKDKLE HHHHCCCCCHHHHHH | 10.34 | 29967540 | |
394 | Acetylation | ESPTVELKDKLECEL HCCCCCHHHHHHHHH | 39.03 | 25038526 | |
394 | Ubiquitination | ESPTVELKDKLECEL HCCCCCHHHHHHHHH | 39.03 | 29967540 | |
396 | Acetylation | PTVELKDKLECELEA CCCCHHHHHHHHHHH | 44.60 | 25038526 | |
396 | Ubiquitination | PTVELKDKLECELEA CCCCHHHHHHHHHHH | 44.60 | 29967540 | |
402 | Ubiquitination | DKLECELEALVGRME HHHHHHHHHHHHHHH | 20.05 | 29967540 | |
408 | Ubiquitination | LEALVGRMEAKANQI HHHHHHHHHHHHHHH | 4.90 | 29967540 | |
411 | Ubiquitination | LVGRMEAKANQITKV HHHHHHHHHHHHHHH | 34.27 | 29967540 | |
417 | Ubiquitination | AKANQITKVRKYQAQ HHHHHHHHHHHHHHH | 41.49 | 29967540 | |
420 | Ubiquitination | NQITKVRKYQAQLEK HHHHHHHHHHHHHHH | 44.71 | 29967540 | |
436 | Ubiquitination | KLEKQKKELKATKKT HHHHHHHHHHHHHHH | 63.64 | 29967540 | |
450 | Ubiquitination | TLDEERNSSSRSGIT HHHHHHHHCCCCCCC | 35.59 | 29967540 | |
452 | Phosphorylation | DEERNSSSRSGITGT HHHHHHCCCCCCCCC | 30.22 | 28787133 | |
453 | Ubiquitination | EERNSSSRSGITGTT HHHHHCCCCCCCCCC | 40.63 | 29967540 | |
462 | Ubiquitination | GITGTTNKKDFMKLR CCCCCCCHHHHHHCC | 52.18 | 29967540 | |
463 | Ubiquitination | ITGTTNKKDFMKLRP CCCCCCHHHHHHCCC | 59.26 | - | |
467 | Ubiquitination | TNKKDFMKLRPGEKR CCHHHHHHCCCCHHH | 41.14 | 29967540 | |
473 | Acetylation | MKLRPGEKRRKNLQL HHCCCCHHHHHHHHH | 64.52 | 30587629 | |
476 | Ubiquitination | RPGEKRRKNLQLLKD CCCHHHHHHHHHHHH | 67.07 | 29967540 | |
493 | Phosphorylation | SIQNSLQSSSLCWDY HHHHHHHHCCCCCCC | 27.47 | 27251275 | |
494 | Phosphorylation | IQNSLQSSSLCWDY- HHHHHHHCCCCCCC- | 17.86 | 27251275 | |
495 | Phosphorylation | QNSLQSSSLCWDY-- HHHHHHCCCCCCC-- | 32.56 | 27251275 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CEP57_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CEP57_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CEP57_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614114 | Mosaic variegated aneuploidy syndrome 2 (MVA2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-53 AND SER-388, AND MASSSPECTROMETRY. |