MYL6B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MYL6B_HUMAN
• UniProt AC: P14649
• Protein Name: Myosin light chain 6B
• Gene Name: MYL6B
• Organism: Homo sapiens (Human).
• Sequence Length: 208
• Protein Description: Regulatory light chain of myosin. Does not bind calcium..
• Protein Sequence: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	VKKPAGPSISKPAAK CCCCCCCCCCCCCCC	38.28	23898821
78	Methylation	EAFELFDRVGDGKIL HHHHHHHHHCCCCEE	27.30	115484231
86	Phosphorylation	VGDGKILYSQCGDVM HCCCCEEEEHHHHHH	10.52	21945579
86	Nitration	VGDGKILYSQCGDVM HCCCCEEEEHHHHHH	10.52	-
87	Phosphorylation	GDGKILYSQCGDVMR CCCCEEEEHHHHHHH	18.62	21945579
89	Glutathionylation	GKILYSQCGDVMRAL CCEEEEHHHHHHHHC	4.06	22555962
101	Phosphorylation	RALGQNPTNAEVLKV HHCCCCCCCHHHHHH	55.39	21712546
107	Acetylation	PTNAEVLKVLGNPKS CCCHHHHHHHCCCCC	40.36	21466224
107	Ubiquitination	PTNAEVLKVLGNPKS CCCHHHHHHHCCCCC	40.36	19608861
107	2-Hydroxyisobutyrylation	PTNAEVLKVLGNPKS CCCHHHHHHHCCCCC	40.36	-
107	Malonylation	PTNAEVLKVLGNPKS CCCHHHHHHHCCCCC	40.36	26320211
114	Phosphorylation	KVLGNPKSDELKSRR HHHCCCCCHHHHHCC	37.26	26074081
146	Phosphorylation	GQGTYEDYLEGFRVF CCCCHHHHHHCEEEE	8.50	27642862
171	O-linked_Glycosylation	AELRHVLTTLGEKMT HHHHHHHHHHHHCCC	20.91	31492838
172	Phosphorylation	ELRHVLTTLGEKMTE HHHHHHHHHHHCCCH	28.71	20068231
172	O-linked_Glycosylation	ELRHVLTTLGEKMTE HHHHHHHHHHHCCCH	28.71	31492838

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MYL6B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MYL6B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MYL6B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IQGA1_HUMAN	IQGAP1	physical	21428964
MYL6_HUMAN	MYL6	physical	22939629
SMAP_HUMAN	C11orf58	physical	22939629
RAC1_HUMAN	RAC1	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.