UniProt ID | FGF8_HUMAN | |
---|---|---|
UniProt AC | P55075 | |
Protein Name | Fibroblast growth factor 8 | |
Gene Name | FGF8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 233 | |
Subcellular Localization | Secreted. | |
Protein Description | Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. Required for normal brain, eye, ear and limb development during embryogenesis. Required for normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. [PubMed: 16384934] | |
Protein Sequence | MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
76 | Phosphorylation | IRTYQLYSRTSGKHV HHHHHHHCCCCCCCE | 37.36 | 24719451 | |
78 | Phosphorylation | TYQLYSRTSGKHVQV HHHHHCCCCCCCEEE | 35.57 | 22964224 | |
79 | Phosphorylation | YQLYSRTSGKHVQVL HHHHCCCCCCCEEEE | 44.74 | 22964224 | |
155 | N-linked_Glycosylation | TEIVLENNYTALQNA EEEEEECCEEEHHCC | 26.59 | UniProtKB CARBOHYD | |
172 | Phosphorylation | EGWYMAFTRKGRPRK CEEEEEEEECCCCCC | 23.18 | 24719451 | |
183 | Phosphorylation | RPRKGSKTRQHQREV CCCCCCCCHHHHHHH | 36.94 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF8_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...