UniProt ID | TT30A_HUMAN | |
---|---|---|
UniProt AC | Q86WT1 | |
Protein Name | Tetratricopeptide repeat protein 30A | |
Gene Name | TTC30A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 665 | |
Subcellular Localization | Cell projection, cilium. | |
Protein Description | Required for polyglutamylation of axonemal tubulin. Plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.. | |
Protein Sequence | MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDALITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEAIKKAVNEYDETMEKYIPVLMAQAKIYWNLENYPMVEKVFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHMIVIHDSVIQECVQFLGHCELYGTNIPAVIEQPLEEERMHVGKNTVTDESRQLKALIYEIIGWNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MAGLSGAQIPDG ---CCCCCCCCCCCC | 31.03 | 24043423 | |
15 | Phosphorylation | QIPDGEFTALVYRLI CCCCCHHHHHHHHHH | 18.12 | 24043423 | |
56 | Phosphorylation | SLLGYCYYRLQEFAL HHHHHHHHHHHHHHH | 10.98 | - | |
111 | Phosphorylation | LLLDNPAYHSRVLRL HHCCCHHHHHHHHHH | 11.11 | 23879269 | |
123 | Ubiquitination | LRLQAAIKYSEGDLP HHHHHHHHHCCCCCC | 37.69 | - | |
209 | Ubiquitination | RQYASALKHIAEIIE HHHHHHHHHHHHHHH | 32.45 | - | |
267 | Phosphorylation | IEYQLRNYEVAQETL HHHHHHCHHHHHHHH | 12.83 | 27732954 | |
394 | Phosphorylation | TEQLRRLTKQVQEAR HHHHHHHHHHHHHHH | 20.02 | 22210691 | |
395 | Ubiquitination | EQLRRLTKQVQEARH HHHHHHHHHHHHHHH | 53.73 | - | |
422 | Ubiquitination | EYDETMEKYIPVLMA HHHHHHHHHHHHHHH | 37.34 | 29967540 | |
449 | Ubiquitination | MVEKVFRKSVEFCND HHHHHHHHHCCCCCC | 47.60 | - | |
475 | Phosphorylation | LFMQENKYKEAIGFY HHHCCCCHHHHHCCC | 26.16 | - | |
476 | Ubiquitination | FMQENKYKEAIGFYE HHCCCCHHHHHCCCH | 42.13 | 29967540 | |
487 | Ubiquitination | GFYEPIVKKHYDNIL CCCHHHHHHHHHCHH | 34.25 | 29967540 | |
488 | Ubiquitination | FYEPIVKKHYDNILN CCHHHHHHHHHCHHC | 36.18 | - | |
569 | Ubiquitination | FGISRVIKSLEPYNK HCHHHHHHHCCCCCC | 46.24 | - | |
577 | Ubiquitination | SLEPYNKKLGTDTWY HCCCCCCCCCCCHHH | 48.81 | - | |
587 | Ubiquitination | TDTWYYAKRCFLSLL CCHHHHHHHHHHHHH | 33.31 | - | |
643 | Ubiquitination | EERMHVGKNTVTDES HHHCCCCCCCCCHHH | 48.64 | - | |
658 | Phosphorylation | RQLKALIYEIIGWNK HHHHHHHHHHHCCCC | 11.26 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TT30A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TT30A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TT30A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...