UniProt ID | CHC10_HUMAN | |
---|---|---|
UniProt AC | Q8WYQ3 | |
Protein Name | Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial | |
Gene Name | CHCHD10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 142 | |
Subcellular Localization | Mitochondrion intermembrane space . Enriched at the cristae junctions. | |
Protein Description | May be involved in the maintenance of mitochondrial organization and mitochondrial cristae structure.. | |
Protein Sequence | MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
133 | Acetylation | SEALKQCKYYHGLSS HHHHHHCHHHHCCCC | 46.48 | 27452117 | |
139 | Phosphorylation | CKYYHGLSSLP---- CHHHHCCCCCC---- | 34.13 | 28348404 | |
140 | Phosphorylation | KYYHGLSSLP----- HHHHCCCCCC----- | 50.10 | 26852163 | |
147 | Phosphorylation | SLP------------ CCC------------ | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHC10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHC10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHC10_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...