UniProt ID | SYUA_RAT | |
---|---|---|
UniProt AC | P37377 | |
Protein Name | Alpha-synuclein | |
Gene Name | Snca | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 140 | |
Subcellular Localization | Cytoplasm, cytosol . Membrane . Nucleus . Cell junction, synapse . Secreted . | |
Protein Description | May be involved in the regulation of dopamine release and transport.. | |
Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDQMGKGEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDVFMKGL -------CCCCHHHH | 10.01 | - | |
6 | Acetylation | --MDVFMKGLSKAKE --CCCCHHHHHHHHH | 45.28 | 22902405 | |
34 | Acetylation | AEAAGKTKEGVLYVG HHHCCCCCCEEEEEC | 56.83 | 22902405 | |
34 | Ubiquitination | AEAAGKTKEGVLYVG HHHCCCCCCEEEEEC | 56.83 | - | |
39 | Phosphorylation | KTKEGVLYVGSKTKE CCCCEEEEECCCCCC | 10.60 | 28432305 | |
42 | Phosphorylation | EGVLYVGSKTKEGVV CEEEEECCCCCCCEE | 27.40 | 28432305 | |
43 | Ubiquitination | GVLYVGSKTKEGVVH EEEEECCCCCCCEEE | 58.65 | - | |
45 | Acetylation | LYVGSKTKEGVVHGV EEECCCCCCCEEEEE | 57.09 | 22902405 | |
72 | O-linked_Glycosylation | NVGGAVVTGVTAVAQ CCCCEEEECCEEEEE | 21.24 | 20676199 | |
96 | Ubiquitination | AAATGFVKKDQMGKG HHHCCCEEHHHCCCC | 48.66 | - | |
96 | Acetylation | AAATGFVKKDQMGKG HHHCCCEEHHHCCCC | 48.66 | 22902405 | |
121 | Phosphorylation | EDMPVDPSSEAYEMP CCCCCCCCCCCCCCC | 36.03 | 22673903 | |
122 | Phosphorylation | DMPVDPSSEAYEMPS CCCCCCCCCCCCCCC | 31.47 | 22673903 | |
125 | Phosphorylation | VDPSSEAYEMPSEEG CCCCCCCCCCCCCCC | 14.54 | 22673903 | |
129 | Phosphorylation | SEAYEMPSEEGYQDY CCCCCCCCCCCCCCC | 47.14 | 22673903 | |
133 | Phosphorylation | EMPSEEGYQDYEPEA CCCCCCCCCCCCCCC | 11.07 | 22673903 | |
136 | Phosphorylation | SEEGYQDYEPEA--- CCCCCCCCCCCC--- | 20.18 | 22673903 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
1 | M | Acetylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYUA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...