UniProt ID | CALR_RAT | |
---|---|---|
UniProt AC | P18418 | |
Protein Name | Calreticulin | |
Gene Name | Calr | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 416 | |
Subcellular Localization | Endoplasmic reticulum lumen . Sarcoplasmic reticulum lumen . | |
Protein Description | Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.. | |
Protein Sequence | MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Acetylation | TNRWVESKHKSDFGK HHHHHHHCCHHHCCC | 41.36 | 22902405 | |
48 | Acetylation | KHKSDFGKFVLSSGK CCHHHCCCEEECCCC | 32.09 | 22902405 | |
55 | Acetylation | KFVLSSGKFYGDQEK CEEECCCCCCCCCCC | 37.04 | 22902405 | |
62 | Acetylation | KFYGDQEKDKGLQTS CCCCCCCCCCCCCCC | 60.14 | 22902405 | |
62 | Succinylation | KFYGDQEKDKGLQTS CCCCCCCCCCCCCCC | 60.14 | 26843850 | |
64 | Succinylation | YGDQEKDKGLQTSQD CCCCCCCCCCCCCHH | 73.00 | 26843850 | |
151 | Acetylation | VHVIFNYKGKNVLIN EEEEEEECCCEEEEC | 65.59 | 22902405 | |
159 | Acetylation | GKNVLINKDIRCKDD CCEEEECCCCCCCCC | 47.76 | 22902405 | |
206 | Acetylation | DWDFLPPKKIKDPDA CCCCCCCCCCCCCCC | 66.25 | 22902405 | |
209 | Acetylation | FLPPKKIKDPDAAKP CCCCCCCCCCCCCCC | 72.58 | 22902405 | |
209 | Succinylation | FLPPKKIKDPDAAKP CCCCCCCCCCCCCCC | 72.58 | 26843850 | |
215 | Acetylation | IKDPDAAKPEDWDER CCCCCCCCCCCCCHH | 51.14 | 22902405 | |
229 | Phosphorylation | RAKIDDPTDSKPEDW HHCCCCCCCCCCCCC | 60.96 | 22673903 | |
231 | Phosphorylation | KIDDPTDSKPEDWDK CCCCCCCCCCCCCCC | 53.22 | 22673903 | |
232 | Acetylation | IDDPTDSKPEDWDKP CCCCCCCCCCCCCCC | 56.06 | 22902405 | |
238 | Succinylation | SKPEDWDKPEHIPDP CCCCCCCCCCCCCCC | 48.31 | 26843850 | |
238 | Acetylation | SKPEDWDKPEHIPDP CCCCCCCCCCCCCCC | 48.31 | 22902405 | |
368 | Acetylation | QDEEQRLKEEEEDKK HHHHHHHHHHHHHHH | 66.33 | 22902405 | |
374 | Acetylation | LKEEEEDKKRKEEEE HHHHHHHHHHHHHHH | 58.73 | 22902405 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALR_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALR_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALR_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...