UniProt ID | GBRAP_RAT | |
---|---|---|
UniProt AC | P60517 | |
Protein Name | Gamma-aminobutyric acid receptor-associated protein | |
Gene Name | Gabarap | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 117 | |
Subcellular Localization | Endomembrane system . Cytoplasm, cytoskeleton . Golgi apparatus membrane . Cytoplasmic vesicle, autophagosome . Cytoplasmic vesicle . Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae ( | |
Protein Description | Involved in apoptosis (By similarity). May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy (By similarity).. | |
Protein Sequence | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBRAP_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBRAP_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBRAP_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...