dbPTM

GBRAP_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GBRAP_RAT
UniProt AC	P60517
Protein Name	Gamma-aminobutyric acid receptor-associated protein
Gene Name	Gabarap
Organism	Rattus norvegicus (Rat).
Sequence Length	117
Subcellular Localization	Endomembrane system . Cytoplasm, cytoskeleton . Golgi apparatus membrane . Cytoplasmic vesicle, autophagosome . Cytoplasmic vesicle . Largely associated with intracellular membrane structures including the Golgi apparatus and postsynaptic cisternae (
Protein Description	Involved in apoptosis (By similarity). May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Involved in autophagy (By similarity)..
Protein Sequence	MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Acetylation	------MKFVYKEEH ------CCCCCCCCC	43.46	22902405
116	Phosphatidylethanolamine amidation	YSDESVYGL------ ECCCCCCCC------	23.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GBRAP_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GBRAP_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GBRAP_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBRG1_RAT	Gabrg1	physical	10900017
GBRG2_RAT	Gabrg2	physical	10900017
GEPH_RAT	Gphn	physical	10900017
CLH1_RAT	Cltc	physical	18027972
CALR_RAT	Calr	physical	17916189

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GBRAP_RAT

Related Literatures of Post-Translational Modification