UniProt ID | SRSF2_RAT | |
---|---|---|
UniProt AC | Q6PDU1 | |
Protein Name | Serine/arginine-rich splicing factor 2 | |
Gene Name | Srsf2 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 221 | |
Subcellular Localization | Nucleus. | |
Protein Description | Necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA. The phosphorylated form (by SRPK2) is required for cellular apoptosis in response to cisplatin treatment (By similarity).. | |
Protein Sequence | MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSRSPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSYGRPPPD ------CCCCCCCCC | 35.97 | - | |
2 | Phosphorylation | ------MSYGRPPPD ------CCCCCCCCC | 35.97 | 27097102 | |
3 | Phosphorylation | -----MSYGRPPPDV -----CCCCCCCCCC | 18.82 | 25575281 | |
22 | Phosphorylation | SLKVDNLTYRTSPDT EEEECCEEEECCHHH | 19.74 | 28689409 | |
23 | Phosphorylation | LKVDNLTYRTSPDTL EEECCEEEECCHHHH | 18.30 | 21738781 | |
25 | Phosphorylation | VDNLTYRTSPDTLRR ECCEEEECCHHHHHH | 33.91 | 21738781 | |
26 | Phosphorylation | DNLTYRTSPDTLRRV CCEEEECCHHHHHHH | 16.27 | 23712012 | |
29 | Phosphorylation | TYRTSPDTLRRVFEK EEECCHHHHHHHHHH | 26.08 | 25403869 | |
36 | Acetylation | TLRRVFEKYGRVGDV HHHHHHHHHCCCCCE | 41.35 | 22902405 | |
52 | Acetylation | IPRDRYTKESRGFAF ECCHHCCCCCCCEEE | 44.77 | 22902405 | |
65 | Acetylation | AFVRFHDKRDAEDAM EEEEECCCCCHHHHH | 43.54 | 22902405 | |
101 | Phosphorylation | RPPDSHHSRRGPPPR CCCCCCCCCCCCCCC | 20.46 | 27097102 | |
140 | Phosphorylation | RSRSRSRSRSRYSRS HHHHHHHHHHHHHHH | 35.54 | 24972320 | |
142 | Phosphorylation | RSRSRSRSRYSRSKS HHHHHHHHHHHHHHH | 36.50 | 22673903 | |
144 | Phosphorylation | RSRSRSRYSRSKSRS HHHHHHHHHHHHHHH | 15.07 | 22673903 | |
145 | Phosphorylation | SRSRSRYSRSKSRSR HHHHHHHHHHHHHHH | 29.03 | 22673903 | |
147 | Phosphorylation | SRSRYSRSKSRSRTR HHHHHHHHHHHHHHH | 29.10 | 22673903 | |
187 | Phosphorylation | RSRSRSRSRSRSPPP HHHHHHCCCCCCCCC | 35.54 | 27097102 | |
189 | Phosphorylation | RSRSRSRSRSPPPVS HHHHCCCCCCCCCCC | 38.05 | 23712012 | |
191 | Phosphorylation | RSRSRSRSPPPVSKR HHCCCCCCCCCCCHH | 42.90 | 23712012 | |
196 | Phosphorylation | SRSPPPVSKRESKSR CCCCCCCCHHHHCCC | 31.59 | 27097102 | |
204 | Phosphorylation | KRESKSRSRSKSPPK HHHHCCCCCCCCCCC | 48.25 | - | |
206 | Phosphorylation | ESKSRSRSKSPPKSP HHCCCCCCCCCCCCH | 38.44 | 23712012 | |
208 | Phosphorylation | KSRSRSKSPPKSPEE CCCCCCCCCCCCHHH | 47.91 | 23712012 | |
212 | Phosphorylation | RSKSPPKSPEEEGAV CCCCCCCCHHHCCCC | 43.23 | 21738781 | |
220 | Phosphorylation | PEEEGAVSS------ HHHCCCCCC------ | 29.78 | 27097102 | |
221 | Phosphorylation | EEEGAVSS------- HHCCCCCC------- | 37.33 | 27097102 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SRSF2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
52 | K | Acetylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SRSF2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SRSF2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...