UniProt ID | VGLU1_RAT | |
---|---|---|
UniProt AC | Q62634 | |
Protein Name | Vesicular glutamate transporter 1 | |
Gene Name | Slc17a7 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 560 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane . Membrane Multi-pass membrane protein . Cell junction, synapse, synaptosome . |
|
Protein Description | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate.. | |
Protein Sequence | MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFNWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLVSYESPALHPSISEEERKYIEDAIGESAKLMNPVTKFNTPWRRFFTSMPVYAIIVANFCRSWTFYLLLISQPAYFEEVFGFEISKVGLVSALPHLVMTIIVPIGGQIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHKTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDESEMEDEVEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | GAETLELSADGRPVT CCCEEEECCCCCCCC | 18.22 | 27115346 | |
169 | Phosphorylation | PSAARVHYGCVIFVR CCCHHHHCCHHHHHH | 14.90 | - | |
186 | Phosphorylation | QGLVEGVTYPACHGI HHHHCCCCCHHHCCH | 34.34 | - | |
187 | Phosphorylation | GLVEGVTYPACHGIW HHHCCCCCHHHCCHH | 6.09 | - | |
272 | Ubiquitination | SISEEERKYIEDAIG CCCHHHHHHHHHHHH | 54.59 | - | |
283 | Ubiquitination | DAIGESAKLMNPVTK HHHHHHHHHCCCCCC | 58.51 | - | |
504 | Phosphorylation | WAEPEEMSEEKCGFV CCCHHHCCHHHCCCC | 45.97 | 16987242 | |
519 | Phosphorylation | GHDQLAGSDESEMED CCHHCCCCCHHHCCC | 32.37 | - | |
522 | Phosphorylation | QLAGSDESEMEDEVE HCCCCCHHHCCCCCC | 47.43 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VGLU1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VGLU1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VGLU1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of VGLU1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...