RL21_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL21_RAT
• UniProt AC: P20280
• Protein Name: 60S ribosomal protein L21
• Gene Name: Rpl21
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 160
• Subcellular Localization: Cytoplasm, cytosol . Cytoplasm . Endoplasmic reticulum . Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (By similarity).
• Protein Description: Component of the large ribosomal subunit..
• Protein Sequence: MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLNGQPAPPREAHFVRTNGKEPELLEPIPYEFMA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Phosphorylation	HGVVPLATYMRIYKK CCCEEHHHEEEEEEC	26.07	23984901
78	Acetylation	AVGIIVNKQVKGKIL EEEEEECCCCCCCHH	45.64	25786129
107	Acetylation	KSRDSFLKRVKENDQ CCHHHHHHHHHHHHH	53.81	22902405
146	Acetylation	HFVRTNGKEPELLEP EEEECCCCCCHHCCC	72.64	22902405

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL21_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL21_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL21_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of RL21_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.