| UniProt ID | RTCB_RAT | |
|---|---|---|
| UniProt AC | Q6AYT3 | |
| Protein Name | tRNA-splicing ligase RtcB homolog {ECO:0000255|HAMAP-Rule:MF_03144} | |
| Gene Name | Rtcb | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 505 | |
| Subcellular Localization | Nucleus. Cytoplasm . Enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low.. | |
| Protein Description | Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs.. | |
| Protein Sequence | MSRNYNDELQFLDKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSPRAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSRNYNDEL ------CCCCCHHHH | 29.27 | 23984901 | |
| 14 | Acetylation | DELQFLDKINKNCWR HHHHHHHHHHHCCCC | 50.77 | 22902405 | |
| 157 | Phosphorylation | HIPVGVGSKGVIPMN CCCCCCCCCCCCCCC | 24.67 | 23984901 | |
| 208 | Phosphorylation | QADPNKVSPRAKKRG CCCCCCCCHHHHHCC | 15.41 | 23984901 | |
| 244 | Acetylation | IFNEYAAKKMGIDHK HHHHHHHHHCCCCCC | 34.81 | 26302492 | |
| 245 | Acetylation | FNEYAAKKMGIDHKG HHHHHHHHCCCCCCC | 37.32 | 26302492 | |
| 251 | Acetylation | KKMGIDHKGQVCVMI HHCCCCCCCCEEEEE | 47.49 | 26302492 | |
| 285 | Acetylation | EKAMKRDKIIVNDRQ HHHHHCCCEEECCHH | 38.06 | 22902405 | |
| 300 | Phosphorylation | LACARIASPEGQDYL HHHHHHCCCCCHHHH | 22.55 | 23984901 | |
| 366 | Ubiquitination | EQHVVDGKERTLLVH EEEEECCCEEEEEEE | 39.29 | - | |
| 465 | Ubiquitination | AIRVASPKLVMEEAP EEEECCCHHHHCCCC | 51.74 | - | |
| 496 | Acetylation | GISKKAIKLRPIAVI CCCHHHEECEEEEEE | 43.22 | 25786129 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RTCB_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RTCB_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RTCB_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RTCB_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...