UniProt ID | DYL1_RAT | |
---|---|---|
UniProt AC | P63170 | |
Protein Name | Dynein light chain 1, cytoplasmic | |
Gene Name | Dynll1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 89 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Nucleus. Mitochondrion. Associated with microtubules. | |
Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.; Binds and inhibits the catalytic activity of neuronal nitric oxide synthase.; Promotes transactivation functions of ESR1 and plays a role in the nuclear localization of ESR1.; Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity (By similarity).. | |
Protein Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Acetylation | CDRKAVIKNADMSEE CCCCHHHCCCCCCHH | 39.21 | 22902405 | |
36 | Acetylation | LEKYNIEKDIAAHIK HHHCCCHHHHHHHHH | 51.11 | 22902405 | |
36 | Ubiquitination | LEKYNIEKDIAAHIK HHHCCCHHHHHHHHH | 51.11 | - | |
43 | Acetylation | KDIAAHIKKEFDKKY HHHHHHHHHHHHHHC | 36.06 | 22902405 | |
43 | Ubiquitination | KDIAAHIKKEFDKKY HHHHHHHHHHHHHHC | 36.06 | - | |
49 | Acetylation | IKKEFDKKYNPTWHC HHHHHHHHCCCCCEE | 52.70 | 22902405 | |
53 | Phosphorylation | FDKKYNPTWHCIVGR HHHHCCCCCEEEECC | 24.97 | 23984901 | |
64 | Phosphorylation | IVGRNFGSYVTHETK EECCCCHHHCCCCHH | 16.58 | - | |
65 | Phosphorylation | VGRNFGSYVTHETKH ECCCCHHHCCCCHHH | 15.11 | - | |
88 | Phosphorylation | VAILLFKSG------ HHHHHHHCC------ | 42.26 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYL1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
88 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYL1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of DYL1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...