ARP3_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ARP3_RAT
• UniProt AC: Q4V7C7
• Protein Name: Actin-related protein 3
• Gene Name: Actr3
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 418
• Subcellular Localization: Cytoplasm, cytoskeleton . Cell projection . In pre-apoptotic cells, colocalizes with MEFV in large specks (pyroptosomes).
• Protein Description: Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. Plays a role in ciliogenesis (By similarity)..
• Protein Sequence: MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGRLPACV ------CCCCCCEEE	16.29	-
53	Acetylation	QAQRRVMKGVDDLDF HHHHHHHCCCCCCCE	53.58	22902405
201	Phosphorylation	PIAGRDITYFIQQLL CCCCCHHHHHHHHHH	19.37	22673903
202	Phosphorylation	IAGRDITYFIQQLLR CCCCHHHHHHHHHHH	10.06	22673903
231	Phosphorylation	AKAVKERYSYVCPDL HHHHHHHHHCCCHHH	12.87	30181290
232	Phosphorylation	KAVKERYSYVCPDLV HHHHHHHHCCCHHHH	19.81	30181290
233	Phosphorylation	AVKERYSYVCPDLVK HHHHHHHCCCHHHHH	9.35	30181290
240	Acetylation	YVCPDLVKEFNKYDT CCCHHHHHHHHHCCC	64.98	-
244	Acetylation	DLVKEFNKYDTDGSK HHHHHHHHCCCCCCH	50.23	22902405
251	Acetylation	KYDTDGSKWIKQYTG HCCCCCCHHHHHHHC	59.47	22902405
254	Acetylation	TDGSKWIKQYTGVNA CCCCHHHHHHHCCCC	35.82	22902405
257	Phosphorylation	SKWIKQYTGVNAISK CHHHHHHHCCCCCCC	31.96	17564427
317	Acetylation	DVRRPLYKNIVLSGG CCCCCCCCCEEECCC	48.13	22902405
348	Acetylation	RTVDARLKLSEELSG HHHHHHHHCCHHHCC	44.40	22902405
361	Acetylation	SGGRLKPKPIDVQVI CCCCCCCCCCCHHHH	53.68	22902405
398	Succinylation	YQVCHTKKDYEEIGP HHHHCCCCCHHHHCH	67.70	26843850
418	Phosphorylation	NPVFGVMS------- CCCCCCCC-------	34.36	30411139

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
257	T	Phosphorylation	Kinase	PRKG1	P00516	GPS

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ARP3_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ARP3_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of ARP3_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.