UniProt ID | ARP3_RAT | |
---|---|---|
UniProt AC | Q4V7C7 | |
Protein Name | Actin-related protein 3 | |
Gene Name | Actr3 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 418 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Cell projection . In pre-apoptotic cells, colocalizes with MEFV in large specks (pyroptosomes). | |
Protein Description | Functions as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Seems to contact the pointed end of the daughter actin filament. Plays a role in ciliogenesis (By similarity).. | |
Protein Sequence | MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGRLPACV ------CCCCCCEEE | 16.29 | - | |
53 | Acetylation | QAQRRVMKGVDDLDF HHHHHHHCCCCCCCE | 53.58 | 22902405 | |
201 | Phosphorylation | PIAGRDITYFIQQLL CCCCCHHHHHHHHHH | 19.37 | 22673903 | |
202 | Phosphorylation | IAGRDITYFIQQLLR CCCCHHHHHHHHHHH | 10.06 | 22673903 | |
231 | Phosphorylation | AKAVKERYSYVCPDL HHHHHHHHHCCCHHH | 12.87 | 30181290 | |
232 | Phosphorylation | KAVKERYSYVCPDLV HHHHHHHHCCCHHHH | 19.81 | 30181290 | |
233 | Phosphorylation | AVKERYSYVCPDLVK HHHHHHHCCCHHHHH | 9.35 | 30181290 | |
240 | Acetylation | YVCPDLVKEFNKYDT CCCHHHHHHHHHCCC | 64.98 | - | |
244 | Acetylation | DLVKEFNKYDTDGSK HHHHHHHHCCCCCCH | 50.23 | 22902405 | |
251 | Acetylation | KYDTDGSKWIKQYTG HCCCCCCHHHHHHHC | 59.47 | 22902405 | |
254 | Acetylation | TDGSKWIKQYTGVNA CCCCHHHHHHHCCCC | 35.82 | 22902405 | |
257 | Phosphorylation | SKWIKQYTGVNAISK CHHHHHHHCCCCCCC | 31.96 | 17564427 | |
317 | Acetylation | DVRRPLYKNIVLSGG CCCCCCCCCEEECCC | 48.13 | 22902405 | |
348 | Acetylation | RTVDARLKLSEELSG HHHHHHHHCCHHHCC | 44.40 | 22902405 | |
361 | Acetylation | SGGRLKPKPIDVQVI CCCCCCCCCCCHHHH | 53.68 | 22902405 | |
398 | Succinylation | YQVCHTKKDYEEIGP HHHHCCCCCHHHHCH | 67.70 | 26843850 | |
418 | Phosphorylation | NPVFGVMS------- CCCCCCCC------- | 34.36 | 30411139 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
257 | T | Phosphorylation | Kinase | PRKG1 | P00516 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARP3_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARP3_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ARP3_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...