OSCP1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OSCP1_RAT
• UniProt AC: Q4QQS3
• Protein Name: Protein OSCP1
• Gene Name: Oscp1
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 379
• Subcellular Localization: Basal cell membrane.
• Protein Description: May be involved in drug clearance in the placenta..
• Protein Sequence: MSVRTLPLLFLNLGGEMLYVLDQRLRAQNIPGDKARKVLNDIISTMFNRKFTEELFKPQELYSKKALRTVYDRLAHASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDSIKGFIQDSPTIIHQVDETFRQLTEIYGSLSAGEFQLIRQTLLIFFQDLHIRVSTFLKDKVQNSNGRFVLPVSGPVPWGIEVPGVIRVFNDKGDEVKRMEFRHGGDYVAAHKEGSFELYGDRVLKLGTNMYSASRPVETHMSATSKNSASRAQENIAPNPLAKEELNFLARLIGGMEIKKPSGPEPGFRLNLFTTDEEEEHAALSRPEELSYEVISIQATQDQQRSEELARIMEEFEMTEQPERNTSKGDDLLAMMDRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
367	Phosphorylation	EQPERNTSKGDDLLA CCCCCCCCCHHHHHH	37.88	23800682

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OSCP1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OSCP1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OSCP1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of OSCP1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.