UniProt ID | BASP1_RAT | |
---|---|---|
UniProt AC | Q05175 | |
Protein Name | Brain acid soluble protein 1 | |
Gene Name | Basp1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 220 | |
Subcellular Localization |
Cell membrane Lipid-anchor. Cell projection, growth cone. Associated with the membranes of growth cones that form the tips of elongating axons. |
|
Protein Description | ||
Protein Sequence | MGSKLSKKKKGYNVNDEKAKDKDKKAEGAGTEEEGTQKESEPQAAADATEVKESAEEKPKDAADGEAKAEEKEADKAAAKEEAPKAEPEKSEGAAEEQPEPAPAPEQEAAAPGPAAGGEAPKAGEASAESTGAADGAPQEEGEAKKTEAPAAGPEAKSDAAPAASDSKPSTEPAPSSKETPAASEAPSSAAKAPAPAAPAAEPQAEAPVASSEQSVAVKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGSKLSKKK ------CCCCHHHCC | 33.22 | - | |
2 | Myristoylation | ------MGSKLSKKK ------CCCCHHHCC | 33.22 | 8193160 | |
18 | Ubiquitination | GYNVNDEKAKDKDKK CCCCCHHHHHHHHHH | 64.70 | - | |
25 | Ubiquitination | KAKDKDKKAEGAGTE HHHHHHHHCCCCCCC | 62.90 | - | |
31 | Phosphorylation | KKAEGAGTEEEGTQK HHCCCCCCCCCCCCC | 39.42 | 30411139 | |
36 | Phosphorylation | AGTEEEGTQKESEPQ CCCCCCCCCCCCCCC | 39.48 | 28432305 | |
38 | Ubiquitination | TEEEGTQKESEPQAA CCCCCCCCCCCCCHH | 64.15 | - | |
40 | Phosphorylation | EEGTQKESEPQAAAD CCCCCCCCCCCHHHH | 62.71 | 28432305 | |
49 | Phosphorylation | PQAAADATEVKESAE CCHHHHHHHHHHHHH | 41.69 | 25403869 | |
52 | Ubiquitination | AADATEVKESAEEKP HHHHHHHHHHHHHCC | 39.45 | - | |
54 | Phosphorylation | DATEVKESAEEKPKD HHHHHHHHHHHCCCC | 34.95 | 28432305 | |
58 | Ubiquitination | VKESAEEKPKDAADG HHHHHHHCCCCCCCC | 49.20 | - | |
58 | Acetylation | VKESAEEKPKDAADG HHHHHHHCCCCCCCC | 49.20 | 22902405 | |
60 | Ubiquitination | ESAEEKPKDAADGEA HHHHHCCCCCCCCHH | 71.69 | - | |
68 | Ubiquitination | DAADGEAKAEEKEAD CCCCCHHHHHHHHHH | 52.62 | - | |
72 | Ubiquitination | GEAKAEEKEADKAAA CHHHHHHHHHHHHHH | 50.11 | - | |
80 | Ubiquitination | EADKAAAKEEAPKAE HHHHHHHHHHCCCCC | 51.89 | - | |
85 | Acetylation | AAKEEAPKAEPEKSE HHHHHCCCCCCCCCC | 72.87 | 22902405 | |
85 | Ubiquitination | AAKEEAPKAEPEKSE HHHHHCCCCCCCCCC | 72.87 | - | |
90 | Ubiquitination | APKAEPEKSEGAAEE CCCCCCCCCCCCCCC | 65.60 | - | |
90 | Acetylation | APKAEPEKSEGAAEE CCCCCCCCCCCCCCC | 65.60 | 22902405 | |
91 | Phosphorylation | PKAEPEKSEGAAEEQ CCCCCCCCCCCCCCC | 39.33 | 23712012 | |
127 | Phosphorylation | APKAGEASAESTGAA CCCCCCCCHHHCCCC | 28.41 | 30240740 | |
130 | Phosphorylation | AGEASAESTGAADGA CCCCCHHHCCCCCCC | 31.68 | 23589303 | |
131 | Phosphorylation | GEASAESTGAADGAP CCCCHHHCCCCCCCC | 23.50 | 25403869 | |
146 | Ubiquitination | QEEGEAKKTEAPAAG HHCCCCCCCCCCCCC | 59.66 | - | |
158 | Phosphorylation | AAGPEAKSDAAPAAS CCCCCCCCCCCCCCC | 39.26 | - | |
165 | Phosphorylation | SDAAPAASDSKPSTE CCCCCCCCCCCCCCC | 44.52 | - | |
167 | Phosphorylation | AAPAASDSKPSTEPA CCCCCCCCCCCCCCC | 43.93 | - | |
170 | Phosphorylation | AASDSKPSTEPAPSS CCCCCCCCCCCCCCC | 49.49 | - | |
184 | Phosphorylation | SKETPAASEAPSSAA CCCCCCHHHCCCHHH | 36.08 | 28432305 | |
188 | Phosphorylation | PAASEAPSSAAKAPA CCHHHCCCHHHCCCC | 39.39 | 25403869 | |
189 | Phosphorylation | AASEAPSSAAKAPAP CHHHCCCHHHCCCCC | 31.05 | 30240740 | |
211 | Phosphorylation | QAEAPVASSEQSVAV CCCCCCCCCCCCCCC | 34.34 | 28432305 | |
212 | Phosphorylation | AEAPVASSEQSVAVK CCCCCCCCCCCCCCC | 29.89 | 28432305 | |
215 | Phosphorylation | PVASSEQSVAVKE-- CCCCCCCCCCCCC-- | 14.16 | 28432305 | |
219 | Acetylation | SEQSVAVKE------ CCCCCCCCC------ | 48.22 | 22902405 | |
219 | Ubiquitination | SEQSVAVKE------ CCCCCCCCC------ | 48.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BASP1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BASP1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BASP1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of BASP1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...