| UniProt ID | DCTN3_MOUSE | |
|---|---|---|
| UniProt AC | Q9Z0Y1 | |
| Protein Name | Dynactin subunit 3 | |
| Gene Name | Dctn3 {ECO:0000312|MGI:MGI:1859251} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 186 | |
| Subcellular Localization | Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Chromosome, centromere, kinetochore. Cytoplasm, cytoskeleton, spindle. Cleavage furrow. Midbody. Localizes to punctate cytoplasmic structures and to the centrosome during | |
| Protein Description | Together with dynein may be involved in spindle assembly and cytokinesis.. | |
| Protein Sequence | MAALTDVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLIKYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVPEHAARLQRLAQIHIQQQDQCVAITEESKALLEGYNKTTMLLSKQFVQWDELLCQLEAAKQVKPAEE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAALTDVQR ------CCCHHHHHH | 15.92 | - | |
| 50 | Ubiquitination | ALGNIASKRERVKIL HHCCCCCHHHHHHHH | 49.62 | 22790023 | |
| 67 | Phosphorylation | KIEDLIKYLDPEYID HHHHHHHHCCHHHHH | 14.89 | - | |
| 72 | Phosphorylation | IKYLDPEYIDRIAIP HHHCCHHHHHHHCCC | 17.32 | 25367039 | |
| 82 | Phosphorylation | RIAIPEASKLQFILA HHCCCCHHHCHHHHH | 32.03 | 25367039 | |
| 96 | Phosphorylation | AEEQFILSQVALLEQ HHHHHHHHHHHHHHH | 20.14 | - | |
| 173 | Glutathionylation | VQWDELLCQLEAAKQ HCHHHHHHHHHHHHC | 7.30 | 24333276 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCTN3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCTN3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCTN3_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
