| UniProt ID | TRY1_HUMAN | |
|---|---|---|
| UniProt AC | P07477 | |
| Protein Name | Trypsin-1 | |
| Gene Name | PRSS1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 247 | |
| Subcellular Localization | Secreted, extracellular space. | |
| Protein Description | Has activity against the synthetic substrates Boc-Phe-Ser-Arg-Mec, Boc-Leu-Thr-Arg-Mec, Boc-Gln-Ala-Arg-Mec and Boc-Val-Pro-Arg-Mec. The single-chain form is more active than the two-chain form against all of these substrates.. | |
| Protein Sequence | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MNPLLILTFVAAALA CCHHHHHHHHHHHHH | 14.74 | 21406692 | |
| 92 | Ubiquitination | EQFINAAKIIRHPQY HHHHHHHHHHHCCCC | 35.93 | 22817900 | |
| 99 | Phosphorylation | KIIRHPQYDRKTLNN HHHHCCCCCCCCCCC | 23.36 | 26330541 | |
| 103 | Phosphorylation | HPQYDRKTLNNDIML CCCCCCCCCCCCEEE | 35.30 | 26330541 | |
| 112 | Acetylation | NNDIMLIKLSSRAVI CCCEEEEEECCHHEE | 38.05 | 12652799 | |
| 154 | Phosphorylation | TASSGADYPDELQCL CCCCCCCCCCHHCCC | 16.43 | 8683601 | |
| 154 | Sulfation | TASSGADYPDELQCL CCCCCCCCCCHHCCC | 16.43 | - | |
| 154 | Sulfation | TASSGADYPDELQCL CCCCCCCCCCHHCCC | 16.43 | 17087724 | |
| 195 | Phosphorylation | FLEGGKDSCQGDSGG EEECCCCCCCCCCCC | 16.30 | - | |
| 215 | Phosphorylation | GQLQGVVSWGDGCAQ CEEEEEEEECCCCCC | 23.96 | 25247763 | |
| 225 | Ubiquitination | DGCAQKNKPGVYTKV CCCCCCCCCCEEEHH | 50.62 | 25015289 | |
| 229 | Phosphorylation | QKNKPGVYTKVYNYV CCCCCCEEEHHHHHH | 13.52 | 26267517 | |
| 231 | Ubiquitination | NKPGVYTKVYNYVKW CCCCEEEHHHHHHHH | 25.65 | 25015289 | |
| 317 | Ubiquitination | ----------------------------------------------------------------------------- ----------------------------------------------------------------------------- | 22817900 | ||
| 450 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ | 25015289 | ||
| 456 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ | 25015289 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRY1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRY1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRY1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SPB8_HUMAN | SERPINB8 | physical | 9402754 | |
| A2AP_HUMAN | SERPINF2 | physical | 2437112 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 167800 | Pancreatitis, hereditary (PCTT) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...