| UniProt ID | DCTN5_HUMAN | |
|---|---|---|
| UniProt AC | Q9BTE1 | |
| Protein Name | Dynactin subunit 5 | |
| Gene Name | DCTN5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 182 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore . | |
| Protein Description | ||
| Protein Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MELGELLY -------CCHHHHHC | 9.65 | 22223895 | |
| 8 | Phosphorylation | MELGELLYNKSEYIE CCHHHHHCCHHHEEE | 32.92 | 29496907 | |
| 10 | Ubiquitination | LGELLYNKSEYIETA HHHHHCCHHHEEEEC | 30.98 | 29967540 | |
| 13 | Phosphorylation | LLYNKSEYIETASGN HHCCHHHEEEECCCC | 15.91 | 29496907 | |
| 21 | Acetylation | IETASGNKVSRQSVL EEECCCCCEECCEEE | 45.15 | 20167786 | |
| 21 | Ubiquitination | IETASGNKVSRQSVL EEECCCCCEECCEEE | 45.15 | 21906983 | |
| 31 | Phosphorylation | RQSVLCGSQNIVLNG CCEEECCCCEEEECC | 21.03 | 24719451 | |
| 48 (in isoform 3) | Phosphorylation | - | 5.18 | 30257219 | |
| 65 | Phosphorylation | GRHCVVKSRSVIRPP CCEEEEECCCEECCC | 20.41 | 20068231 | |
| 67 | Phosphorylation | HCVVKSRSVIRPPFK EEEEECCCEECCCCC | 29.05 | 20068231 | |
| 74 | Malonylation | SVIRPPFKKFSKGVA CEECCCCCCCCCCEE | 59.70 | 32601280 | |
| 74 | Ubiquitination | SVIRPPFKKFSKGVA CEECCCCCCCCCCEE | 59.70 | - | |
| 75 | Ubiquitination | VIRPPFKKFSKGVAF EECCCCCCCCCCEEE | 56.07 | - | |
| 123 | Acetylation | IGRRCVLKDCCKILD ECCCHHHHHHHHHCC | 28.46 | 25953088 | |
| 123 | Ubiquitination | IGRRCVLKDCCKILD ECCCHHHHHHHHHCC | 28.46 | - | |
| 170 | Ubiquitination | ELMIDVTKSYYQKFL HHHHHHHHHHHHHHC | 35.99 | 22817900 | |
| 175 | Ubiquitination | VTKSYYQKFLPLTQV HHHHHHHHHCCCCCC | 32.52 | 21890473 | |
| 175 | Ubiquitination | VTKSYYQKFLPLTQV HHHHHHHHHCCCCCC | 32.52 | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCTN5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCTN5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCTN5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FATE1_HUMAN | FATE1 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...