UniProt ID | DCTN5_HUMAN | |
---|---|---|
UniProt AC | Q9BTE1 | |
Protein Name | Dynactin subunit 5 | |
Gene Name | DCTN5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 182 | |
Subcellular Localization | Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore . | |
Protein Description | ||
Protein Sequence | MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MELGELLY -------CCHHHHHC | 9.65 | 22223895 | |
8 | Phosphorylation | MELGELLYNKSEYIE CCHHHHHCCHHHEEE | 32.92 | 29496907 | |
10 | Ubiquitination | LGELLYNKSEYIETA HHHHHCCHHHEEEEC | 30.98 | 29967540 | |
13 | Phosphorylation | LLYNKSEYIETASGN HHCCHHHEEEECCCC | 15.91 | 29496907 | |
21 | Acetylation | IETASGNKVSRQSVL EEECCCCCEECCEEE | 45.15 | 20167786 | |
21 | Ubiquitination | IETASGNKVSRQSVL EEECCCCCEECCEEE | 45.15 | 21906983 | |
31 | Phosphorylation | RQSVLCGSQNIVLNG CCEEECCCCEEEECC | 21.03 | 24719451 | |
48 (in isoform 3) | Phosphorylation | - | 5.18 | 30257219 | |
65 | Phosphorylation | GRHCVVKSRSVIRPP CCEEEEECCCEECCC | 20.41 | 20068231 | |
67 | Phosphorylation | HCVVKSRSVIRPPFK EEEEECCCEECCCCC | 29.05 | 20068231 | |
74 | Malonylation | SVIRPPFKKFSKGVA CEECCCCCCCCCCEE | 59.70 | 32601280 | |
74 | Ubiquitination | SVIRPPFKKFSKGVA CEECCCCCCCCCCEE | 59.70 | - | |
75 | Ubiquitination | VIRPPFKKFSKGVAF EECCCCCCCCCCEEE | 56.07 | - | |
123 | Acetylation | IGRRCVLKDCCKILD ECCCHHHHHHHHHCC | 28.46 | 25953088 | |
123 | Ubiquitination | IGRRCVLKDCCKILD ECCCHHHHHHHHHCC | 28.46 | - | |
170 | Ubiquitination | ELMIDVTKSYYQKFL HHHHHHHHHHHHHHC | 35.99 | 22817900 | |
175 | Ubiquitination | VTKSYYQKFLPLTQV HHHHHHHHHCCCCCC | 32.52 | 21890473 | |
175 | Ubiquitination | VTKSYYQKFLPLTQV HHHHHHHHHCCCCCC | 32.52 | 21906983 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCTN5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCTN5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCTN5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FATE1_HUMAN | FATE1 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...