| UniProt ID | GINM1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NU53 | |
| Protein Name | Glycoprotein integral membrane protein 1 | |
| Gene Name | GINM1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 330 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MEGAPPGSLALRLLLFVALPASGWLTTGAPEPPPLSGAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVTEIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKLPETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSNVFPVFFQFLNIMVVGITGAAVVITILKVFFPVSEYKGILQLDKVDVIPVTAINLYPDGPEKRAENLEDKTCI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | O-linked_Glycosylation | LPASGWLTTGAPEPP CCCCCCCCCCCCCCC | OGP | ||
| 27 | O-linked_Glycosylation | PASGWLTTGAPEPPP CCCCCCCCCCCCCCC | OGP | ||
| 36 | O-linked_Glycosylation | APEPPPLSGAPQDGI CCCCCCCCCCCCCCE | OGP | ||
| 46 | N-linked_Glycosylation | PQDGIRINVTTLKDD CCCCEEEEEEEECCC | UniProtKB CARBOHYD | ||
| 64 | N-linked_Glycosylation | SKQQVVLNITYESGQ CCEEEEEEEEECCCC | UniProtKB CARBOHYD | ||
| 111 | Phosphorylation | KEYFGIVSVRILVHE HCEEEEEEEEEEEEE | 24719451 | ||
| 166 | N-linked_Glycosylation | RGVLRHSNYTLPLEE CCCCCCCCEEEECCH | UniProtKB CARBOHYD | ||
| 183 | Phosphorylation | LYSISRDSDILFTLP HHHHHCCCCEEEECC | 22964224 | ||
| 188 | Phosphorylation | RDSDILFTLPNLSKK CCCCEEEECCCCCCC | 22964224 | ||
| 191 | N-linked_Glycosylation | DILFTLPNLSKKESV CEEEECCCCCCCCCH | UniProtKB CARBOHYD | ||
| 197 | O-linked_Glycosylation | PNLSKKESVSSLQTT CCCCCCCCHHHHHHH | 55828215 | ||
| 199 | O-linked_Glycosylation | LSKKESVSSLQTTSQ CCCCCCHHHHHHHHH | 55828219 | ||
| 200 | O-linked_Glycosylation | SKKESVSSLQTTSQY CCCCCHHHHHHHHHH | 55828225 | ||
| 203 | O-linked_Glycosylation | ESVSSLQTTSQYLIR CCHHHHHHHHHHHHH | 55828231 | ||
| 204 | O-linked_Glycosylation | SVSSLQTTSQYLIRN CHHHHHHHHHHHHHC | 55828237 | ||
| 205 | O-linked_Glycosylation | VSSLQTTSQYLIRNV HHHHHHHHHHHHHCC | 55828243 | ||
| 214 | O-linked_Glycosylation | YLIRNVETTVDEDVL HHHHCCEEECCCCCC | 55829307 | ||
| 215 | O-linked_Glycosylation | LIRNVETTVDEDVLP HHHCCEEECCCCCCC | 55829313 | ||
| 224 | Ubiquitination | DEDVLPGKLPETPLR CCCCCCCCCCCCCCC | - | ||
| 228 | Phosphorylation | LPGKLPETPLRAEPP CCCCCCCCCCCCCCC | 24719451 | ||
| 293 | Phosphorylation | VFFPVSEYKGILQLD HHCCHHHHCCCEECC | - | ||
| 294 | Ubiquitination | FFPVSEYKGILQLDK HCCHHHHCCCEECCC | 22817900 | ||
| 301 | Ubiquitination | KGILQLDKVDVIPVT CCCEECCCCCEEEEE | 23000965 | ||
| 319 | Ubiquitination | LYPDGPEKRAENLED CCCCCHHHHHHHCCC | 23000965 | ||
| 327 | Ubiquitination | RAENLEDKTCI---- HHHHCCCCCCC---- | 21906983 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GINM1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GINM1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GINM1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
