| UniProt ID | VAMP7_HUMAN | |
|---|---|---|
| UniProt AC | P51809 | |
| Protein Name | Vesicle-associated membrane protein 7 | |
| Gene Name | VAMP7 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 220 | |
| Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle membrane Single-pass type IV membrane protein. Golgi apparatus, trans-Golgi network membrane Single-pass type IV membrane protein. Late endosome membrane Single-pass type IV membrane protein. Lysosome membrane S |
|
| Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal fusion. Required for calcium regulated lysosomal exocytosis. Involved in the export of chylomicrons from the endoplasmic reticulum to the cis Golgi. Required for exocytosis of mediators during eosinophil and neutrophil degranulation, and target cell killing by natural killer cells. Required for focal exocytosis of late endocytic vesicles during phagosome formation.. | |
| Protein Sequence | MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAILFAVVA ------CCHHHHHHC | 13.75 | - | |
| 12 | Phosphorylation | FAVVARGTTILAKHA HHHHCCCCEEHHCCC | 12.71 | 19413330 | |
| 13 | Phosphorylation | AVVARGTTILAKHAW HHHCCCCEEHHCCCC | 19.47 | 19413330 | |
| 38 | Phosphorylation | QILAKIPSENNKLTY HHHHHCCCCCCCEEE | 57.33 | 19845377 | |
| 42 | Malonylation | KIPSENNKLTYSHGN HCCCCCCCEEEECCC | 54.51 | 26320211 | |
| 45 | Phosphorylation | SENNKLTYSHGNYLF CCCCCEEEECCCCHH | 14.76 | - | |
| 50 | Phosphorylation | LTYSHGNYLFHYICQ EEEECCCCHHEEEEC | 18.48 | 19845377 | |
| 62 | Phosphorylation | ICQDRIVYLCITDDD EECCCEEEEEEECCH | 8.09 | 20068231 | |
| 84 (in isoform 3) | Ubiquitination | - | 65.20 | 21890473 | |
| 96 (in isoform 3) | Ubiquitination | - | 29.22 | 21890473 | |
| 119 (in isoform 3) | Ubiquitination | - | 59.61 | 21890473 | |
| 121 | Ubiquitination | LKHHSENKGLDKVME HHHHHCCCCHHHHHH | 57.72 | - | |
| 125 | Ubiquitination | SENKGLDKVMETQAQ HCCCCHHHHHHHHHH | 48.82 | 21890473 | |
| 125 (in isoform 2) | Ubiquitination | - | 48.82 | 21890473 | |
| 125 (in isoform 1) | Ubiquitination | - | 48.82 | 21890473 | |
| 127 | Sulfoxidation | NKGLDKVMETQAQVD CCCHHHHHHHHHHHH | 5.93 | 21406390 | |
| 131 (in isoform 3) | Ubiquitination | - | 20.84 | 21890473 | |
| 137 (in isoform 1) | Ubiquitination | - | 44.32 | 21890473 | |
| 137 (in isoform 2) | Ubiquitination | - | 44.32 | 21890473 | |
| 137 | Ubiquitination | QAQVDELKGIMVRNI HHHHHHHHCCEEECC | 44.32 | 21906983 | |
| 160 (in isoform 1) | Ubiquitination | - | 51.23 | 21890473 | |
| 160 | Ubiquitination | RLELLIDKTENLVDS EEEEEEECCCCCCCC | 51.23 | 21906983 | |
| 161 | Phosphorylation | LELLIDKTENLVDSS EEEEEECCCCCCCCC | 26.76 | 20068231 | |
| 167 | Phosphorylation | KTENLVDSSVTFKTT CCCCCCCCCCCCCCC | 21.16 | 23401153 | |
| 168 | Phosphorylation | TENLVDSSVTFKTTS CCCCCCCCCCCCCCC | 22.25 | 29255136 | |
| 170 | Phosphorylation | NLVDSSVTFKTTSRN CCCCCCCCCCCCCHH | 22.74 | 29255136 | |
| 172 | Ubiquitination | VDSSVTFKTTSRNLA CCCCCCCCCCCHHHH | 41.34 | 21890473 | |
| 172 (in isoform 1) | Ubiquitination | - | 41.34 | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 45 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VAMP7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VAMP7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AP3D1_HUMAN | AP3D1 | physical | 12853575 | |
| SNP29_HUMAN | SNAP29 | physical | 12853575 | |
| AP3M1_HUMAN | AP3M1 | physical | 12853575 | |
| SNP25_HUMAN | SNAP25 | physical | 12853575 | |
| STX1A_HUMAN | STX1A | physical | 12853575 | |
| SNP23_HUMAN | SNAP23 | physical | 12853575 | |
| STX4_HUMAN | STX4 | physical | 12853575 | |
| SNP23_HUMAN | SNAP23 | physical | 9614185 | |
| ANR27_HUMAN | ANKRD27 | physical | 19745841 | |
| STX6_HUMAN | STX6 | physical | 19557002 | |
| STX7_HUMAN | STX7 | physical | 19557002 | |
| STX8_HUMAN | STX8 | physical | 19557002 | |
| 2AAA_HUMAN | PPP2R1A | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-168, AND MASSSPECTROMETRY. | |
