NFIP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NFIP1_HUMAN
• UniProt AC: Q9BT67
• Protein Name: NEDD4 family-interacting protein 1
• Gene Name: NDFIP1
• Organism: Homo sapiens (Human).
• Sequence Length: 221
• Subcellular Localization: Endosome membrane ; Multi-pass membrane protein . Golgi apparatus membrane . Cell junction, synapse, synaptosome . Cell projection, dendrite . Secreted . Detected in exosomes and secreted via the exosomal pathway (PubMed:18819914).
• Protein Description: Activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, and consequently modulates the stability of their targets. As a result, controls many cellular processes. Prevents chronic T-helper cell-mediated inflammation by activating ITCH and thus controlling JUNB degradation (By similarity). Promotes pancreatic beta cell death through degradation of JUNB and inhibition of the unfolded protein response, leading to reduction of insulin secretion. [PubMed: 26319551 Restricts the production of proinflammatory cytokines in effector Th17 T-cells by promoting ITCH-mediated ubiquitination and degradation of RORC (By similarity Together with NDFIP2, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination (By similarity Regulates peripheral T-cell tolerance to self and foreign antigens, forcing the exit of naive CD4+ T-cells from the cell cycle before they become effector T-cells (By similarity Negatively regulates RLR-mediated antiviral response by promoting SMURF1-mediated ubiquitination and subsequent degradation of MAVS]
• Protein Sequence: MALALAALAAVEPACGSRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFMLTFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MALALAALA ------CHHHHHHHH	11.09	22223895
15	S-palmitoylation	LAAVEPACGSRYQQL HHHHCHHHCHHHHHH	8.12	19801377
17	Phosphorylation	AVEPACGSRYQQLQN HHCHHHCHHHHHHHC	27.91	28348404
19	Phosphorylation	EPACGSRYQQLQNEE CHHHCHHHHHHHCCH	11.43	25884760
42	Phosphorylation	AGDAPPPYSSISAES CCCCCCCCCCCCHHH	22.33	25884760
43	Phosphorylation	GDAPPPYSSISAESA CCCCCCCCCCCHHHH	27.28	-
49	Phosphorylation	YSSISAESAAYFDYK CCCCCHHHHHCCCCC	20.23	25884760
52	Phosphorylation	ISAESAAYFDYKDES CCHHHHHCCCCCCCC	9.19	25884760
55	Phosphorylation	ESAAYFDYKDESGFP HHHHCCCCCCCCCCC	15.50	25884760
56	Ubiquitination	SAAYFDYKDESGFPK HHHCCCCCCCCCCCC	57.79	29967540
59	Phosphorylation	YFDYKDESGFPKPPS CCCCCCCCCCCCCCC	56.73	26356563
63 (in isoform 1)	Ubiquitination	-	68.26	21890473
63	Ubiquitination	KDESGFPKPPSYNVA CCCCCCCCCCCCCCC	68.26	22817900
66	Phosphorylation	SGFPKPPSYNVATTL CCCCCCCCCCCCCCC	37.56	26356563
67	Phosphorylation	GFPKPPSYNVATTLP CCCCCCCCCCCCCCC	21.30	25884760
75	Phosphorylation	NVATTLPSYDEAERT CCCCCCCCCCHHHHH	48.61	26356563
76	Phosphorylation	VATTLPSYDEAERTK CCCCCCCCCHHHHHH	18.83	25884760
83 (in isoform 1)	Ubiquitination	-	50.91	21890473
83	Ubiquitination	YDEAERTKAEATIPL CCHHHHHHCEEEECC	50.91	32142685
147	Phosphorylation	TTSAAGRYGAISGFG HHCHHHHCCCCCHHH	15.25	20068231
151	Phosphorylation	AGRYGAISGFGLSLI HHHCCCCCHHHHHHH	27.77	20068231
156	Phosphorylation	AISGFGLSLIKWILI CCCHHHHHHHHHHHH	28.55	20068231
201	Ubiquitination	RGFINYAKVRKMPET HHHHHHHHHHCCCHH	32.01	22817900
204	Ubiquitination	INYAKVRKMPETFSN HHHHHHHCCCHHHCC	62.89	32142685
204 (in isoform 1)	Ubiquitination	-	62.89	21890473
208	Phosphorylation	KVRKMPETFSNLPRT HHHCCCHHHCCCCCE	26.88	29759185
210	Phosphorylation	RKMPETFSNLPRTRV HCCCHHHCCCCCEEE	44.89	29759185

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	NEDD4	P46934	PMID:15252135

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NFIP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NFIP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NRAM2_HUMAN	SLC11A2	physical	19706893
PTEN_HUMAN	PTEN	physical	20534535
EGFR_HUMAN	EGFR	physical	20534535
PTEN_HUMAN	PTEN	physical	22213801
NED4L_HUMAN	NEDD4L	physical	22213801
MAVS_HUMAN	MAVS	physical	23087404
SMUF1_HUMAN	SMURF1	physical	23087404
UB2L3_HUMAN	UBE2L3	physical	25632008
ITCH_HUMAN	ITCH	physical	25632008
ITCH_HUMAN	ITCH	physical	26245901
NEDD4_HUMAN	NEDD4	physical	27173227
SYUA_HUMAN	SNCA	physical	27173227

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.