| UniProt ID | GALT1_HUMAN | |
|---|---|---|
| UniProt AC | Q10472 | |
| Protein Name | Polypeptide N-acetylgalactosaminyltransferase 1 | |
| Gene Name | GALNT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 559 | |
| Subcellular Localization |
Polypeptide N-acetylgalactosaminyltransferase 1: Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Polypeptide N-acetylgalactosaminyltransferase 1 soluble form: Secreted. |
|
| Protein Description | Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a broad spectrum of substrates for peptides such as EA2, Muc5AC, Muc1a, Muc1b and Muc7.. | |
| Protein Sequence | MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQIINKNNRRLAEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLENIYPDSQIPRHYFSLGEIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDCNGSRSQQWLLRNVTLPEIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | S-palmitoylation | -MRKFAYCKVVLATS -CCCHHHHHHHHHHH | 2.12 | 29575903 | |
| 95 | N-linked_Glycosylation | ASEMIALNRSLPDVR HHHHHHHCCCCCCCE | 23.60 | UniProtKB CARBOHYD | |
| 172 | Ubiquitination | RPLESYVKKLKVPVH CHHHHHHHHHCCCEE | 44.12 | - | |
| 175 | Ubiquitination | ESYVKKLKVPVHVIR HHHHHHHCCCEEEEE | 54.06 | - | |
| 302 | Phosphorylation | LFSIDRDYFQEIGTY CEEECHHHHHHHCCC | 14.20 | 25332170 | |
| 309 | Phosphorylation | YFQEIGTYDAGMDIW HHHHHCCCCCCCCCC | 9.89 | 25332170 | |
| 338 | Phosphorylation | GGTLEIVTCSHVGHV CCEEEEEEECCHHHE | 17.60 | 25332170 | |
| 353 | O-linked_Glycosylation | FRKATPYTFPGGTGQ ECCCCCCCCCCCCCE | 25.26 | OGP | |
| 385 | Phosphorylation | KNFFYIISPGVTKVD HCEEEEECCCCCCCC | 13.17 | - | |
| 390 | Ubiquitination | IISPGVTKVDYGDIS EECCCCCCCCCCCCH | 30.61 | 2190698 | |
| 390 (in isoform 1) | Ubiquitination | - | 30.61 | 21906983 | |
| 526 | Ubiquitination | NSNQCLDKATEEDSQ CCCCCCCCCCCCCCC | 44.23 | - | |
| 552 | N-linked_Glycosylation | SQQWLLRNVTLPEIF HHHHHHHCCCCCCCC | 30.97 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GALT1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GALT1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GALT1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GALT1_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
