UniProt ID | CALCB_HUMAN | |
---|---|---|
UniProt AC | P10092 | |
Protein Name | Calcitonin gene-related peptide 2 | |
Gene Name | CALCB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 127 | |
Subcellular Localization | Secreted. | |
Protein Description | CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.. | |
Protein Sequence | MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | O-linked_Glycosylation | PFRSALESSPDPATL CHHHHHHHCCCHHCC | 48.28 | 55830353 | |
35 | O-linked_Glycosylation | FRSALESSPDPATLS HHHHHHHCCCHHCCC | 24.77 | 55830357 | |
40 | O-linked_Glycosylation | ESSPDPATLSKEDAR HHCCCHHCCCHHHHH | 36.63 | 55830361 | |
106 | O-linked_Glycosylation | RSGGMVKSNFVPTNV HCCCCCCCCCCCCCC | 24.88 | 55828463 | |
111 | O-linked_Glycosylation | VKSNFVPTNVGSKAF CCCCCCCCCCCCCHH | 36.92 | 55828467 | |
115 | O-linked_Glycosylation | FVPTNVGSKAFGRRR CCCCCCCCCHHCCHH | 19.27 | 55828471 | |
118 | Phenylalanine amide | TNVGSKAFGRRRRDL CCCCCCHHCCHHHHC | 10.07 | - | |
118 | Amidation | TNVGSKAFGRRRRDL CCCCCCHHCCHHHHC | 10.07 | 2322288 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALCB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALCB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALCB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CALCB_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Amidation | |
Reference | PubMed |
"Isolation, purification and characterization of beta-hCGRP from humanspinal cord."; Wimalawansa S.J., Morris H.R., Etienne A., Blench I., Panico M.,McIntyre I.; Biochem. Biophys. Res. Commun. 167:993-1000(1990). Cited for: PROTEIN SEQUENCE OF 82-86 AND 104-118, AMIDATION AT PHE-118, ANDDISULFIDE BOND. |