| UniProt ID | PAQR1_HUMAN | |
|---|---|---|
| UniProt AC | Q96A54 | |
| Protein Name | Adiponectin receptor protein 1 {ECO:0000303|PubMed:12802337} | |
| Gene Name | ADIPOR1 {ECO:0000312|HGNC:HGNC:24040} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 375 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . Localized to the cell membrane and intracellular organelles. |
|
| Protein Description | Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. [PubMed: 25855295] | |
| Protein Sequence | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSSHKGSVV ------CCCCCCCCE | 25002506 | ||
| 3 | Phosphorylation | -----MSSHKGSVVA -----CCCCCCCCEE | 25002506 | ||
| 7 | Phosphorylation | -MSSHKGSVVAQGNG -CCCCCCCCEECCCC | 80527403 | ||
| 18 | Phosphorylation | QGNGAPASNREADTV CCCCCCCCCCCCCCE | 24719451 | ||
| 24 | Phosphorylation | ASNREADTVELAELG CCCCCCCCEEHHHHH | 80527401 | ||
| 37 | Ubiquitination | LGPLLEEKGKRVIAN HHHHHHHHCCEEECC | 32015554 | ||
| 53 | Phosphorylation | PKAEEEQTCPVPQEE CCCCHHCCCCCCHHH | 80527405 | ||
| 68 | Phosphorylation | EEEVRVLTLPLQAHH HHHHEEEECCHHHHH | 28060719 | ||
| 79 | Ubiquitination | QAHHAMEKMEEFVYK HHHHHHHHHHHHHHH | 32015554 | ||
| 85 | Phosphorylation | EKMEEFVYKVWEGRW HHHHHHHHHHHCCCC | 25884760 | ||
| 86 | Ubiquitination | KMEEFVYKVWEGRWR HHHHHHHHHHCCCCE | 22817900 | ||
| 126 | Ubiquitination | PSFRACFKSIFRIHT HHHHHHHHHHHCHHH | 21963094 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAQR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAQR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DP13A_HUMAN | APPL1 | physical | 16622416 | |
| NAA20_HUMAN | NAA20 | physical | 21988832 | |
| IKBL1_HUMAN | NFKBIL1 | physical | 21988832 | |
| DPH3_HUMAN | DPH3 | physical | 21988832 | |
| FA45A_HUMAN | FAM45A | physical | 28514442 | |
| WFS1_HUMAN | WFS1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...