UniProt ID | PAQR1_HUMAN | |
---|---|---|
UniProt AC | Q96A54 | |
Protein Name | Adiponectin receptor protein 1 {ECO:0000303|PubMed:12802337} | |
Gene Name | ADIPOR1 {ECO:0000312|HGNC:HGNC:24040} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 375 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . Localized to the cell membrane and intracellular organelles. |
|
Protein Description | Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. [PubMed: 25855295] | |
Protein Sequence | MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSHKGSVV ------CCCCCCCCE | 25002506 | ||
3 | Phosphorylation | -----MSSHKGSVVA -----CCCCCCCCEE | 25002506 | ||
7 | Phosphorylation | -MSSHKGSVVAQGNG -CCCCCCCCEECCCC | 80527403 | ||
18 | Phosphorylation | QGNGAPASNREADTV CCCCCCCCCCCCCCE | 24719451 | ||
24 | Phosphorylation | ASNREADTVELAELG CCCCCCCCEEHHHHH | 80527401 | ||
37 | Ubiquitination | LGPLLEEKGKRVIAN HHHHHHHHCCEEECC | 32015554 | ||
53 | Phosphorylation | PKAEEEQTCPVPQEE CCCCHHCCCCCCHHH | 80527405 | ||
68 | Phosphorylation | EEEVRVLTLPLQAHH HHHHEEEECCHHHHH | 28060719 | ||
79 | Ubiquitination | QAHHAMEKMEEFVYK HHHHHHHHHHHHHHH | 32015554 | ||
85 | Phosphorylation | EKMEEFVYKVWEGRW HHHHHHHHHHHCCCC | 25884760 | ||
86 | Ubiquitination | KMEEFVYKVWEGRWR HHHHHHHHHHCCCCE | 22817900 | ||
126 | Ubiquitination | PSFRACFKSIFRIHT HHHHHHHHHHHCHHH | 21963094 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAQR1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAQR1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DP13A_HUMAN | APPL1 | physical | 16622416 | |
NAA20_HUMAN | NAA20 | physical | 21988832 | |
IKBL1_HUMAN | NFKBIL1 | physical | 21988832 | |
DPH3_HUMAN | DPH3 | physical | 21988832 | |
FA45A_HUMAN | FAM45A | physical | 28514442 | |
WFS1_HUMAN | WFS1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...