UniProt ID | NAA20_HUMAN | |
---|---|---|
UniProt AC | P61599 | |
Protein Name | N-alpha-acetyltransferase 20 | |
Gene Name | NAA20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration.. | |
Protein Sequence | MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
103 | Ubiquitination | LEEISERKGGFFVDL HHHHHHHCCCEEEEE | 60.37 | - | |
124 | Ubiquitination | QVAVNMYKQLGYSVY HHHHHHHHHHCCHHH | 28.42 | 21890473 | |
137 | Phosphorylation | VYRTVIEYYSASNGE HHHHHHHHHHHHCCC | 7.50 | - | |
138 | Phosphorylation | YRTVIEYYSASNGEP HHHHHHHHHHHCCCC | 5.74 | - | |
157 | Phosphorylation | YDMRKALSRDTEKKS HHHHHHHCCCCCCCC | 32.73 | - | |
160 | Phosphorylation | RKALSRDTEKKSIIP HHHHCCCCCCCCCCC | 48.90 | - | |
162 | Ubiquitination | ALSRDTEKKSIIPLP HHCCCCCCCCCCCCC | 54.64 | - | |
163 | Ubiquitination | LSRDTEKKSIIPLPH HCCCCCCCCCCCCCC | 40.43 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAA20_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAA20_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAA20_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IKKB_HUMAN | IKBKB | physical | 19716809 | |
NHEJ1_HUMAN | NHEJ1 | physical | 22939629 | |
SMAD5_HUMAN | SMAD5 | physical | 22939629 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...