UniProt ID | YK55_YEAST | |
---|---|---|
UniProt AC | P36155 | |
Protein Name | Uncharacterized protein YKR075C | |
Gene Name | YKR075C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 307 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTSLDDTIISYQNIMLLDNMTNYNKPAIDYFHHEFNDASLEISASWTLLLKMRKHKLLRLPSCSSEDVLDYNMYLVRLHHCLWRRWSINHYGLQNSKSNPLSINWNKETDVTVLYGPDLTNIDSNENEISPVQNQIDQKQTKNLKSALKKNTECWVTEEVDEINASIESNDNALVKLEDISCPSSVDSHTSSIFDQHSTCTKISSIDEDSEDLMNEKKEQFPRKLKFNQAVMKREIDSKGTIRESLININDIQHSRHHRRHHRRHHHHHHQNSSHSDETIKEAHYEFSNYTFGTMEEDIFYRNQVVF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
141 | Phosphorylation | NQIDQKQTKNLKSAL HHHCHHHHHCHHHHH | 29.00 | 27017623 | |
204 | Phosphorylation | HSTCTKISSIDEDSE CCCCCCCCCCCCCHH | 23.85 | 27017623 | |
205 | Phosphorylation | STCTKISSIDEDSED CCCCCCCCCCCCHHH | 37.22 | 23749301 | |
210 | Phosphorylation | ISSIDEDSEDLMNEK CCCCCCCHHHHHHHH | 30.84 | 27214570 | |
217 | Ubiquitination | SEDLMNEKKEQFPRK HHHHHHHHHHHHCHH | 57.51 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YK55_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YK55_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YK55_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-205, AND MASSSPECTROMETRY. |