UniProt ID | FCF1_HUMAN | |
---|---|---|
UniProt AC | Q9Y324 | |
Protein Name | rRNA-processing protein FCF1 homolog | |
Gene Name | FCF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 198 | |
Subcellular Localization | Nucleus, nucleolus. | |
Protein Description | Essential protein involved in pre-rRNA processing and 40S ribosomal subunit assembly.. | |
Protein Sequence | MGKQKKTRKYATMKRMLSLRDQRLKEKDRLKPKKKEKKDPSALKEREVPQHPSCLFFQYNTQLGPPYHILVDTNFINFSIKAKLDLVQSMMDCLYAKCIPCITDCVMAEIEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCLVQRVTQHKCYIVATVDRDLKRRIRKIPGVPIMYISNHRYNIERMPDDYGAPRF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | KQKKTRKYATMKRML CCHHHHHHHHHHHHH | 12.19 | 24719451 | |
12 | Phosphorylation | KKTRKYATMKRMLSL HHHHHHHHHHHHHHH | 21.82 | 24719451 | |
18 | Phosphorylation | ATMKRMLSLRDQRLK HHHHHHHHHHHHHHH | 16.41 | 21712546 | |
83 | Acetylation | INFSIKAKLDLVQSM CCCCHHHHHHHHHHH | 37.22 | 26051181 | |
137 | Ubiquitination | ERLPCTHKGTYADDC CCCCCCCCCCCCCCC | 34.49 | - | |
137 | Acetylation | ERLPCTHKGTYADDC CCCCCCCCCCCCCCC | 34.49 | 25953088 | |
153 | Ubiquitination | VQRVTQHKCYIVATV HHHHHCCCCEEEEEE | 20.93 | - | |
178 | Phosphorylation | IPGVPIMYISNHRYN CCCCCEEEEECCCCC | 11.25 | - | |
193 | Phosphorylation | IERMPDDYGAPRF-- CCCCCCCCCCCCC-- | 23.67 | 23532336 | |
197 | Methylation | PDDYGAPRF------ CCCCCCCCC------ | 49.74 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCF1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...