UniProt ID | ENDOU_HUMAN | |
---|---|---|
UniProt AC | P21128 | |
Protein Name | Poly(U)-specific endoribonuclease | |
Gene Name | ENDOU | |
Organism | Homo sapiens (Human). | |
Sequence Length | 410 | |
Subcellular Localization | Secreted . | |
Protein Description | Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini.. | |
Protein Sequence | MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
145 | Phosphorylation | KEEIQSISEKIYRAD HHHHHHHHHHHHHHC | 37.78 | 24114839 | |
149 | Phosphorylation | QSISEKIYRADTNKA HHHHHHHHHHCCCHH | 15.71 | 24114839 | |
178 | Ubiquitination | PSETRNQVDRCPKPL CHHHHCHHCCCCCCH | 5.98 | 29967540 | |
195 | Phosphorylation | YVNEKLFSKPTYAAF HHCHHHCCCHHHHHH | 48.43 | 24719451 | |
200 | Ubiquitination | LFSKPTYAAFINLLN HCCCHHHHHHHHHHH | 9.81 | 29967540 | |
241 | Ubiquitination | IMKTAVMKELYSFLH HHHHHHHHHHHHHHH | 37.66 | 29967540 | |
272 | Phosphorylation | NMWFGLYSRGNEEGD HCCEEECCCCCCCCC | 38.46 | 24719451 | |
394 | Phosphorylation | YTWDKSTYGNGKKYI EEECCCCCCCCCEEE | 18.71 | 28152594 | |
403 | Phosphorylation | NGKKYIATAYIVSST CCCEEEEEEEEEECC | 15.50 | - | |
405 | Phosphorylation | KKYIATAYIVSST-- CEEEEEEEEEECC-- | 9.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ENDOU_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ENDOU_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ENDOU_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of ENDOU_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...