dbPTM

ENDOU_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ENDOU_HUMAN
UniProt AC	P21128
Protein Name	Poly(U)-specific endoribonuclease
Gene Name	ENDOU
Organism	Homo sapiens (Human).
Sequence Length	410
Subcellular Localization	Secreted .
Protein Description	Endoribonuclease that cleaves single-stranded RNAs at uridylates and releases products that have 2'-3'-cyclic phosphate termini..
Protein Sequence	MRACISLVLAVLCGLAWAGKIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLNSQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAVMKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
145	Phosphorylation	KEEIQSISEKIYRAD HHHHHHHHHHHHHHC	37.78	24114839
149	Phosphorylation	QSISEKIYRADTNKA HHHHHHHHHHCCCHH	15.71	24114839
178	Ubiquitination	PSETRNQVDRCPKPL CHHHHCHHCCCCCCH	5.98	29967540
195	Phosphorylation	YVNEKLFSKPTYAAF HHCHHHCCCHHHHHH	48.43	24719451
200	Ubiquitination	LFSKPTYAAFINLLN HCCCHHHHHHHHHHH	9.81	29967540
241	Ubiquitination	IMKTAVMKELYSFLH HHHHHHHHHHHHHHH	37.66	29967540
272	Phosphorylation	NMWFGLYSRGNEEGD HCCEEECCCCCCCCC	38.46	24719451
394	Phosphorylation	YTWDKSTYGNGKKYI EEECCCCCCCCCEEE	18.71	28152594
403	Phosphorylation	NGKKYIATAYIVSST CCCEEEEEEEEEECC	15.50	-
405	Phosphorylation	KKYIATAYIVSST-- CEEEEEEEEEECC--	9.48	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ENDOU_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ENDOU_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ENDOU_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ENDOU_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ENDOU_HUMAN

Related Literatures of Post-Translational Modification